![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla019114 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 92aa MW: 10109.3 Da PI: 8.7756 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 103.2 | 1.6e-32 | 25 | 81 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 vrY eC+kNhAa+lGg avDGC+Efm+ ge+gt +al+CaACgCHRnFHRrev+ e Cla019114 25 VVRYAECQKNHAAKLGGFAVDGCREFMAR-GEDGTEEALNCAACGCHRNFHRREVDAE 81 79**************************8.999*********************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 8.9E-30 | 26 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 4.0E-26 | 26 | 90 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 7.5E-27 | 27 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.362 | 28 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048509 | Biological Process | regulation of meristem development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MKKRLVVVKK SDGSSGRRRS GSSSVVRYAE CQKNHAAKLG GFAVDGCREF MARGEDGTEE 60 ALNCAACGCH RNFHRREVDA EVVFEYSPPN SN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681813 | 2e-84 | LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030. | |||
GenBank | LN713256 | 2e-84 | LN713256.1 Cucumis melo genomic chromosome, chr_2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022135253.1 | 2e-56 | mini zinc finger protein 3-like | ||||
Swissprot | Q2Q493 | 2e-35 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
TrEMBL | A0A0A0LSA6 | 4e-54 | A0A0A0LSA6_CUCSA; Uncharacterized protein | ||||
TrEMBL | A0A1S3BWG1 | 5e-54 | A0A1S3BWG1_CUCME; mini zinc finger protein 3-like | ||||
STRING | XP_008453204.1 | 9e-55 | (Cucumis melo) | ||||
STRING | XP_004138166.1 | 7e-55 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18835.1 | 8e-37 | mini zinc finger |