PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

MYB

Protein Properties

Length: 229aa MW: 26494.4 Da PI: 8.3047

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla018657	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	57.5	3.1e-18	4	49	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ Cla018657 4 RGHWRPAEDEKLRELVERYGPHNWNAIAQKLQ-GRSGKSCRLRWFNQ 49 899***************************.*********996 PP
2	Myb_DNA-binding	52.1	1.5e-16	56	99	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l ++ +G++ W+ Iar ++ gRt++ +k++w+ Cla018657 56 RTPFTEEEEERLMASHRVHGNR-WAIIARLFP-GRTDNAVKNHWHV 99 679*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.942	1	54	IPR017930	Myb domain
SMART	SM00717	3.6E-15	3	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.24E-30	4	97	IPR009057	Homeodomain-like
Pfam	PF00249	6.8E-18	4	49	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-27	5	57	IPR009057	Homeodomain-like
CDD	cd00167	3.23E-14	7	48	No hit	No description
PROSITE profile	PS51294	21.063	55	105	IPR017930	Myb domain
SMART	SM00717	5.4E-14	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	1.8E-13	56	98	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-20	58	103	IPR009057	Homeodomain-like
CDD	cd00167	1.00E-10	58	98	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 229 aa Download sequence Send to blast
MCSRGHWRPA EDEKLRELVE RYGPHNWNAI AQKLQGRSGK SCRLRWFNQL DPRINRTPFT 60 EEEEERLMAS HRVHGNRWAI IARLFPGRTD NAVKNHWHVI MARRSRSNRS KTLTQTQTPT 120 PSSLHHNNHN HRLLLSSFLQ LHPYPTPTPV SFIPKPPDNA THNSIHYYDF LHVNTESING 180 SEVIDNSRKE EDYEEVNNQE AATVDDVGPV LPFIDFFSAS QTSNNSISS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-33	4	104	7	107	B-MYB
1mse_C	2e-33	1	104	1	104	C-Myb DNA-Binding Domain
1msf_C	2e-33	1	104	1	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00145	DAP	Transfer from AT1G17950	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681932	1e-168	LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBank	LN713266	1e-168	LN713266.1 Cucumis melo genomic chromosome, chr_12.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008455801.1	1e-112	PREDICTED: transcriptional activator Myb-like
Swissprot	Q6R0C4	2e-78	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A1S3C1Q2	1e-111	A0A1S3C1Q2_CUCME; transcriptional activator Myb-like
STRING	XP_008455801.1	1e-112	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	4e-74	myb domain protein 52

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]