PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla016980 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 230aa MW: 26154.4 Da PI: 9.9289 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 55 | 1.8e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+ +++q+G g+W++ + + g+ R++k+c++rw +yl Cla016980 14 KGPWTPEEDHKLLAYIQQHGHGSWRALPPKAGLERCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.8 | 1.9e-16 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ +E++ +++++++lG++ W++Ia+++ +Rt++++k++w+++l Cla016980 67 RGKFSSQEEQAIIQLHALLGNR-WSAIASHLH-KRTDNEIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-24 | 6 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.405 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.74E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.08E-9 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.282 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.6E-27 | 65 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.0E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.68E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 230 aa Download sequence Send to blast |
MGRSPYCDSS GLKKGPWTPE EDHKLLAYIQ QHGHGSWRAL PPKAGLERCG KSCRLRWTNY 60 LRPDIKRGKF SSQEEQAIIQ LHALLGNRWS AIASHLHKRT DNEIKNYWNT HLKKKLIQMG 120 MDPITHKPMK NNNEETKSKD NINSTLSHMA QWETARLEAE ERLARQSKFQ PIPSFNQNRF 180 GSSGDVESPT TSSTGQRGVA DDMQSSGSGG AESKSYCWPD TILGEFLRFR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-26 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681841 | 4e-51 | LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011. | |||
GenBank | LN713258 | 4e-51 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008443378.1 | 1e-139 | PREDICTED: transcription factor MYB76-like isoform X2 | ||||
Swissprot | Q9LE63 | 4e-94 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | A0A1S3B8N3 | 1e-137 | A0A1S3B8N3_CUCME; transcription factor MYB76-like isoform X2 | ||||
STRING | XP_008443377.1 | 1e-137 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF835 | 34 | 127 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15310.1 | 4e-85 | myb domain protein 16 |