![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cla009629 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 140aa MW: 15781.2 Da PI: 6.774 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 135.3 | 1.9e-42 | 54 | 129 | 1 | 76 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +Cq++gC+adls a+ yhrrhkvCe+h+ka++v+++gleqrfCqqCsrfh++sefD++krsCrrrLa+hnerrrk Cla009629 54 RCQADGCNADLSGARPYHRRHKVCEFHAKAAAVILAGLEQRFCQQCSRFHAVSEFDDTKRSCRRRLAGHNERRRKI 129 6*************************************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 9.6E-35 | 48 | 116 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.154 | 52 | 129 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.83E-39 | 53 | 133 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.0E-33 | 55 | 128 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MANSEDQGWD DMVVEEDDDN DDNEEIGFVE DERRRRSALT GGRGGSGGRT TVARCQADGC 60 NADLSGARPY HRRHKVCEFH AKAAAVILAG LEQRFCQQCS RFHAVSEFDD TKRSCRRRLA 120 GHNERRRKIL PDFHGQSSTN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-36 | 45 | 128 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681875 | 4e-71 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
GenBank | LN713262 | 4e-71 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004134953.1 | 5e-77 | PREDICTED: squamosa promoter-binding protein 1 | ||||
Swissprot | Q38741 | 1e-41 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A0A0KK74 | 1e-75 | A0A0A0KK74_CUCSA; Uncharacterized protein | ||||
STRING | XP_004155646.1 | 2e-76 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 1e-38 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|