PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus

Family

MYB

Protein Properties

Length: 212aa MW: 23950.9 Da PI: 11.0878

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cla007815	genome	ICuGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.6	2.5e-17	27	72	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l ++v+q+G+ +W+ Ia+++ gR++k+c++rw++ Cla007815 27 RGHWRPAEDNKLRQLVEQFGPQNWNYIAEHFE-GRSGKSCRLRWYNQ 72 899***************************.**********96 PP
2	Myb_DNA-binding	51.2	2.8e-16	79	122	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++++++eE+e+l+ +++G++ W++Iar++ gRt++ +k++++ Cla007815 79 KNPFSEEEEERLLMFQQLHGNK-WALIARHFK-GRTDNAVKNHYHV 122 689*****************.****9.*********86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51257	6	1	25	No hit	No description
PROSITE profile	PS51294	22.486	22	77	IPR017930	Myb domain
SuperFamily	SSF46689	9.36E-29	25	120	IPR009057	Homeodomain-like
SMART	SM00717	1.1E-13	26	75	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-26	28	80	IPR009057	Homeodomain-like
Pfam	PF13921	4.7E-18	30	90	No hit	No description
CDD	cd00167	5.43E-13	30	71	No hit	No description
PROSITE profile	PS51294	17.238	78	128	IPR017930	Myb domain
SMART	SM00717	9.7E-14	78	126	IPR001005	SANT/Myb domain
CDD	cd00167	3.70E-10	81	121	No hit	No description
Gene3D	G3DSA:1.10.10.60	9.4E-20	81	126	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 212 aa Download sequence Send to blast
MMRSRSSSSS GGSSGGGGGS SGVSCYRGHW RPAEDNKLRQ LVEQFGPQNW NYIAEHFEGR 60 SGKSCRLRWY NQLDPNINKN PFSEEEEERL LMFQQLHGNK WALIARHFKG RTDNAVKNHY 120 HVIMARRRRE RFTIFTNHNN NNNNILRTRH SLLPFSKTTA VKWTPLTAAP PVVLGNGRGK 180 SSLPAVVASG SGETEDHKRR IPFIDFLGMG SS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	2e-27	27	127	4	104	MYB PROTO-ONCOGENE PROTEIN
1mse_C	2e-27	27	127	4	104	C-Myb DNA-Binding Domain
1msf_C	2e-27	27	127	4	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681912	1e-146	LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
GenBank	LN713265	1e-146	LN713265.1 Cucumis melo genomic chromosome, chr_11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004147366.1	1e-131	PREDICTED: transcriptional activator Myb
Swissprot	Q6R0C4	1e-56	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A0A0LM98	1e-130	A0A0A0LM98_CUCSA; Uncharacterized protein
STRING	XP_004147366.1	1e-131	(Cucumis sativus)
STRING	XP_004171372.1	1e-131	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G33450.1	1e-60	myb domain protein 69

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]