PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

M-type_MADS

Protein Properties

Length: 97aa MW: 11306.1 Da PI: 10.4057

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10033176m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102	2.2e-32	25	75	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++ Ciclev10033176m 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 75 79***********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.543	17	77	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.4E-41	17	76	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.83E-30	18	77	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.43E-38	18	76	No hit	No description
PRINTS	PR00404	6.5E-34	19	39	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	19	73	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.4E-27	26	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-34	39	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.5E-34	54	75	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 97 aa Download sequence Send to blast
MEFPKQNPES SSQSKKIGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA 60 LIVFSSRGRL YEYANNRFSF SLFLFFLFQV SFNFYI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	1e-20	17	85	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ccl.20045	1e-128	fruit

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB218613	1e-125	AB218613.1 Citrus unshiu CitMADS6 mRNA for MADS-box protein, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006437205.2	3e-48	agamous-like MADS-box protein AGL5 isoform X2
Refseq	XP_024956880.1	3e-48	agamous-like MADS-box protein AGL5
Swissprot	P29385	3e-38	AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBL	V4TKW4	1e-62	V4TKW4_9ROSI; Uncharacterized protein
STRING	XP_006437206.1	2e-63	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	7e-28	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	Ciclev10033176m
Entrez Gene	18045454

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Rathnakumar K, et al. Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability. J. Thromb. Haemost., 2016. 14(8): p. 1655-67 [PMID:27241812] Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks. Development, 2016. 143(18): p. 3372-81 [PMID:27510967] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]