PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

MYB

Protein Properties

Length: 186aa MW: 21464.6 Da PI: 10.385

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10027480m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	33.5	9.7e-11	15	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l d+++ +G g W+ +++ ++ +c++rw++yl Ciclev10027480m 15 RGAWTAAEDKILTDYITIYGEGKWRYLPKRAV-NKFM-SCRLRWLNYL 60 89****************************.9999.******97 PP
2	Myb_DNA-binding	28.8	2.8e-09	66	102	1	39
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 rg+ + +Edel++++ ++l ++ W++Ia +++ gRt+++ Ciclev10027480m 66 RGNISHDEDELIIRLLNLLANR-WSLIAGRLP-GRTDNE 102 78999***************.*****.**96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.96	10	64	IPR017930	Myb domain
SuperFamily	SSF46689	1.52E-20	13	102	IPR009057	Homeodomain-like
SMART	SM00717	9.0E-4	14	62	IPR001005	SANT/Myb domain
Pfam	PF00249	1.0E-7	15	60	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.9E-18	16	67	IPR009057	Homeodomain-like
CDD	cd00167	1.23E-6	17	60	No hit	No description
PROSITE profile	PS51294	8.43	65	109	IPR017930	Myb domain
SMART	SM00717	0.0015	65	107	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-7	66	102	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.5E-15	68	102	IPR009057	Homeodomain-like
CDD	cd00167	2.85E-5	70	102	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 186 aa Download sequence Send to blast
MGRFPCCSKE EGLNRGAWTA AEDKILTDYI TIYGEGKWRY LPKRAVNKFM SCRLRWLNYL 60 RPDIKRGNIS HDEDELIIRL LNLLANRWSL IAGRLPGRTD NENMKSRIIG APTLENKKLQ 120 DHHQSPSSST ACTRKTLNQC QEKPKLGSKK FIAKTDSYPI RTRASKRTKA LFFSTPEQEK 180 SYGQDQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-16	13	101	25	114	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis.
Uniprot	TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269\|PubMed:15361138}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024036075.1	3e-93	transcription factor TT2
Swissprot	Q9FJA2	7e-42	TT2_ARATH; Transcription factor TT2
TrEMBL	V4SRX2	1e-137	V4SRX2_9ROSI; Uncharacterized protein (Fragment)
STRING	XP_006426646.1	1e-137	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM33293	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	1e-32	myb domain protein 3

Link Out ? help Back to Top
Phytozome	Ciclev10027480m
Entrez Gene	18036247

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Liu C,Jun JH,Dixon RA MYB5 and MYB14 Play Pivotal Roles in Seed Coat Polymer Biosynthesis in Medicago truncatula. Plant Physiol., 2014. 165(4): p. 1424-1439 [PMID:24948832] Zhu Z, et al. Characterization of the cis elements in the proximal promoter regions of the anthocyanin pathway genes reveals a common regulatory logic that governs pathway regulation. J. Exp. Bot., 2015. 66(13): p. 3775-89 [PMID:25911741] Liu Y,Shi Z,Maximova SN,Payne MJ,Guiltinan MJ Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao. BMC Plant Biol., 2015. 15: p. 160 [PMID:26109181] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li Y, et al. Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis. Sci Rep, 2016. 6: p. 30514 [PMID:27465838] Li C,Zhang B,Chen B,Ji L,Yu H Site-specific phosphorylation of TRANSPARENT TESTA GLABRA1 mediates carbon partitioning in Arabidopsis seeds. Nat Commun, 2018. 9(1): p. 571 [PMID:29422671]