PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10024294m | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 174aa MW: 19320.4 Da PI: 7.5036 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 176 | 3.7e-55 | 33 | 128 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf++y+++lk yl++yreleg Ciclev10024294m 33 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDNYADQLKRYLHRYRELEG 126 89*******************************************************************************************9 PP NF-YB 96 ek 97 e+ Ciclev10024294m 127 ER 128 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.3E-54 | 29 | 151 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.05E-40 | 35 | 150 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.2E-28 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.0E-19 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 5.0E-19 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 5.0E-19 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MVDSAGHNLE SYDNSYNFTV GASSGTDQDG VIKEQDRLLP IANVGRIMKQ ILPPNAKISK 60 EAKETMQECV SEFISFVTGE ASDKCHKEKR KTVNGDDICW ALATLGFDNY ADQLKRYLHR 120 YRELEGERAN QNKAGNNNNG KDSEPAAQRK HNTLSSMPLK FNATDTSNGS RRF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-45 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 32 | 123 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006480108.1 | 1e-102 | nuclear transcription factor Y subunit B-5 | ||||
Refseq | XP_024045102.1 | 1e-102 | nuclear transcription factor Y subunit B-5 | ||||
Swissprot | O82248 | 9e-63 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A067H5N9 | 1e-101 | A0A067H5N9_CITSI; Uncharacterized protein | ||||
STRING | XP_006480108.1 | 1e-102 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 1e-63 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10024294m |
Publications ? help Back to Top | |||
---|---|---|---|
|