![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10017679m | ||||||||
Common Name | CICLE_v10017679mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 124aa MW: 14891.1 Da PI: 11.0278 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.8 | 6.6e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W +eEd +l+ +++++G +W+ +++ g+ R++k+c++rw +yl Ciclev10017679m 14 KGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNYL 61 799*****************99**********99************97 PP | |||||||
2 | Myb_DNA-binding | 62.9 | 6.4e-20 | 67 | 110 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg++T+eEde ++++++qlG++ W++Ia++++ +Rt++++k++w++ Ciclev10017679m 67 RGNFTQEEDETIIKLHQQLGNR-WSAIASRLP-RRTDNEIKNHWHT 110 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 16.046 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.7E-30 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-10 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.8E-13 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.4E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.39E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 27.516 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.1E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-17 | 67 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-27 | 69 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.35E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MVKAPGSEKP SLRKGSWAPE EDRKLIAYIR RYGIWNWSEM PKYAGLLRCG KSCRLRWMNY 60 LRPDIRRGNF TQEEDETIIK LHQQLGNRWS AIASRLPRRT DNEIKNHWHT RLSKKRLTKD 120 NQQQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 6e-30 | 10 | 115 | 3 | 107 | B-MYB |
1h8a_C | 8e-30 | 10 | 115 | 23 | 127 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006449185.2 | 9e-88 | myb-related protein 308 | ||||
Swissprot | Q7XBH4 | 9e-55 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
TrEMBL | V4UE25 | 6e-87 | V4UE25_9ROSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006467925.1 | 5e-86 | (Citrus sinensis) | ||||
STRING | XP_006449185.1 | 1e-87 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-56 | myb domain protein 14 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10017679m |
Entrez Gene | 18052417 |
Publications ? help Back to Top | |||
---|---|---|---|
|