PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

MYB

Protein Properties

Length: 262aa MW: 29821.3 Da PI: 6.7869

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10016303m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.3	2.7e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+ +v+++G +W+ +++ g+ R++k+c++rw +yl Ciclev10016303m 14 KGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNYL 61 799*******************************************97 PP
2	Myb_DNA-binding	54.3	3.1e-17	67	110	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T+eE+++++++++ lG++ W++Ia+ ++ gRt++++k++w++ Ciclev10016303m 67 RGNYTKEEEDIIIRLHESLGNR-WSAIAAQLP-GRTDNEIKNHWHT 110 899*****************.*****.*********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.744	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	1.13E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	5.6E-11	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-14	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.5E-24	15	68	IPR009057	Homeodomain-like
CDD	cd00167	2.68E-10	16	61	No hit	No description
PROSITE profile	PS51294	25.855	62	116	IPR017930	Myb domain
SMART	SM00717	7.7E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	8.6E-16	67	110	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-26	69	117	IPR009057	Homeodomain-like
CDD	cd00167	6.35E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 262 aa Download sequence Send to blast
MVRTPCCDKT GLKKGTWTPE EDRKLIAYVT KYGYWNWRQL PKYAGLARCG KSCRLRWMNY 60 LRPNIKRGNY TKEEEDIIIR LHESLGNRWS AIAAQLPGRT DNEIKNHWHT SLKKRLKRNS 120 ITNTNGAKDT PKRKDPEIYN HDDTEANPVQ ESNLVDIIPP ILESSSSSSD QISSLSMTTD 180 ITSVGKNTNT TDELILDNNN EAVFHPYADT SGSFWTEPFY SDNFYNLYIS NDFQAPSLLP 240 ADPGFASVHS PFLDGEIILW P*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-30	12	116	5	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, stems and flowers (PubMed:17015446, PubMed:19161942). Expressed in stomatal guard cells (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006447415.1	0.0	transcription factor MYB15
Refseq	XP_006469810.1	0.0	transcription factor MYB15-like
Swissprot	Q9LTC4	3e-72	MYB15_ARATH; Transcription factor MYB15
TrEMBL	V4U974	0.0	V4U974_9ROSI; Uncharacterized protein
STRING	XP_006469810.1	0.0	(Citrus sinensis)
STRING	XP_006447415.1	0.0	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	2e-69	myb domain protein 15

Link Out ? help Back to Top
Phytozome	Ciclev10016303m
Entrez Gene	18053187

Publications ? help Back to Top
Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]