![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10013334m | ||||||||
Common Name | CICLE_v10013334mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 185aa MW: 21236.6 Da PI: 6.4134 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.1 | 5e-15 | 84 | 131 | 5 | 52 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 +++rr+++NRe+ArrsR RK++ ++eL v L +eN++L ++l++ Ciclev10013334m 84 RKQRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLVDKLNHV 131 689***************************************999976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.880.10 | 6.6E-6 | 44 | 98 | IPR008917 | Transcription factor, Skn-1-like, DNA-binding domain |
SMART | SM00338 | 4.2E-15 | 80 | 144 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.22 | 82 | 132 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 8.3E-13 | 84 | 130 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.13E-13 | 84 | 132 | No hit | No description |
CDD | cd14702 | 8.90E-19 | 85 | 132 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 87 | 102 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.6E-13 | 99 | 157 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
EVSGLHYLLA PSLSQYSSHY ISSSDHNTST CQFDRFLNPI LNFHQIPPQV PEIINSQTSS 60 FSSNNSTSDE AEEQQQQSMI INERKQRRMI SNRESARRSR MRKQKHLDEL WSQVVWLRNE 120 NHQLVDKLNH VSGCHDKVMQ ENAQLKVEAT ELRQMLTDLQ LNSHYSSLKD LDDVPCCNAA 180 DLLG* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 96 | 103 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00389 | DAP | Transfer from AT3G30530 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006430890.2 | 1e-135 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 4e-43 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | V4SYL0 | 1e-133 | V4SYL0_9ROSI; Uncharacterized protein (Fragment) | ||||
STRING | XP_006430890.1 | 1e-134 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 6e-49 | basic leucine-zipper 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10013334m |
Entrez Gene | 18039756 |
Publications ? help Back to Top | |||
---|---|---|---|
|