PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

WRKY

Protein Properties

Length: 160aa MW: 18301.1 Da PI: 5.1038

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10009761m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	99.1	2.8e-31	98	156	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v++tYeg H+h+ Ciclev10009761m 98 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDRDDPSYVITTYEGFHTHQ 156 59********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.1E-33	84	157	IPR003657	WRKY domain
SuperFamily	SSF118290	1.7E-28	91	157	IPR003657	WRKY domain
PROSITE profile	PS50811	29.379	93	158	IPR003657	WRKY domain
SMART	SM00774	1.1E-36	98	157	IPR003657	WRKY domain
Pfam	PF03106	3.9E-25	99	156	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MSNINLIPQD SPESDSAEKT NFELSEYLTF DEWFEDDQAS KLFGYVQNPV YRANEVVEPG 60 GTSTHFEGPS NSDNDSGREK KPVKERVAFK TKSDVEILDD GFKWRKYGKK MVKNSPNPRN 120 YYKCSVDGCP VKKRVERDRD DPSYVITTYE GFHTHQSNP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-24	88	155	7	74	Probable WRKY transcription factor 4
2lex_A	1e-24	88	155	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB573149	1e-114	AB573149.1 Citrus unshiu genomic DNA, polyembryony locus, cultivar: Miyagawa wase.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006474454.1	1e-108	probable WRKY transcription factor 50 isoform X1
Refseq	XP_024033930.1	1e-108	probable WRKY transcription factor 50 isoform X1
Swissprot	Q8VWQ5	1e-49	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A067GDY4	1e-115	A0A067GDY4_CITSI; Uncharacterized protein
TrEMBL	V4UPS5	1e-115	V4UPS5_9ROSI; Uncharacterized protein
STRING	XP_006453040.1	1e-115	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6121	27	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	5e-52	WRKY DNA-binding protein 50

Link Out ? help Back to Top
Phytozome	Ciclev10009761m
Entrez Gene	18055749

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]