PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Ciclev10006893m

Common Name

CICLE_v10006893mg

Organism

Citrus clementina

Taxonomic ID

85681

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus

Family

HSF

Protein Properties

Length: 78aa MW: 8575.54 Da PI: 4.4885

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Ciclev10006893m	genome	ICGC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	81.2	1.5e-25	20	78	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl k+y++++d++++e++sws+n+nsfvv+++ efa+ +Lp++Fkh+nf+SF+RQLn+Y Ciclev10006893m 20 FLIKTYDMVDDSSTDEIVSWSDNKNSFVVWNPPEFARLLLPTFFKHNNFSSFIRQLNTY 78 9*********************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46785	5.1E-25	16	78	IPR011991	Winged helix-turn-helix DNA-binding domain
Gene3D	G3DSA:1.10.10.10	8.7E-27	16	78	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	7.8E-20	16	78	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-16	20	43	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	1.8E-21	20	78	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-16	58	70	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-16	71	78	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
METSAASGGP GGVGGGPAPF LIKTYDMVDD SSTDEIVSWS DNKNSFVVWN PPEFARLLLP 60 TFFKHNNFSS FIRQLNTY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	6e-17	9	78	17	87	Heat shock factor protein 1
5d5v_B	6e-17	9	78	17	87	Heat shock factor protein 1
5d5v_D	6e-17	9	78	17	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024035656.1	4e-50	heat stress transcription factor A-5
Swissprot	Q94BZ5	2e-29	HSFA5_ARATH; Heat stress transcription factor A-5
TrEMBL	A0A2H5PML6	2e-48	A0A2H5PML6_CITUN; Uncharacterized protein
TrEMBL	A0A2H5PMM0	1e-48	A0A2H5PMM0_CITUN; Uncharacterized protein
TrEMBL	V4SBE0	1e-50	V4SBE0_9ROSI; Uncharacterized protein (Fragment)
STRING	XP_006421026.1	2e-51	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM965	28	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G13980.1	4e-31	HSF family protein

Link Out ? help Back to Top
Phytozome	Ciclev10006893m
Entrez Gene	18031731

Publications ? help Back to Top
Reňák D,Gibalová A,Solcová K,Honys D A new link between stress response and nucleolar function during pollen development in Arabidopsis mediated by AtREN1 protein. Plant Cell Environ., 2014. 37(3): p. 670-83 [PMID:23961845]