PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10006868m | ||||||||
Common Name | CICLE_v10006868mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 124aa MW: 13727.8 Da PI: 7.7578 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 124 | 7.8e-39 | 6 | 105 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +CaaC++lrr+C++dC++apyfpa++p++fa+vhk++G s+v ++l++lp e r +a+++++ eAe+r++dPvyG+v++i+ lqqq+++++++l Ciclev10006868m 6 RCAACRHLRRRCPSDCIFAPYFPANDPHRFACVHKIYGSSKVGNMLQDLPVELRAEAADAICIEAECRVQDPVYGCVRMISLLQQQIHNAESQL 99 6********************************************************************************************* PP DUF260 95 allkee 100 +++++e Ciclev10006868m 100 VKARAE 105 *99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.376 | 5 | 106 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.9E-38 | 6 | 103 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 124 aa Download sequence Send to blast |
MSTSSRCAAC RHLRRRCPSD CIFAPYFPAN DPHRFACVHK IYGSSKVGNM LQDLPVELRA 60 EAADAICIEA ECRVQDPVYG CVRMISLLQQ QIHNAESQLV KARAEIAVLG SHAQELRHHG 120 QDI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 7e-33 | 2 | 106 | 7 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 7e-33 | 2 | 106 | 7 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006421851.1 | 8e-87 | LOB domain-containing protein 24 | ||||
Swissprot | P59468 | 5e-47 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | V4SDL7 | 2e-85 | V4SDL7_9ROSI; Uncharacterized protein | ||||
STRING | XP_006421851.1 | 3e-86 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 6e-32 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10006868m |
Entrez Gene | 18031708 |