 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Ciclev10006654m |
Common Name | CICLE_v10006654mg |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
Family |
M-type_MADS |
Protein Properties |
Length: 76aa MW: 8613.03 Da PI: 9.717 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Ciclev10006654m | genome | ICGC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 99 | 1.9e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien++ rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye+ss
Ciclev10006654m 9 KKIENDTSRQVTFSKRRNGMLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59
78***********************************************96 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6bz1_A | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6c9l_A | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. |
Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | EU032532 | 5e-97 | EU032532.1 Citrus sinensis SOC1-like protein 2 mRNA, complete cds. |