PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10006654m
Common NameCICLE_v10006654mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family M-type_MADS
Protein Properties Length: 76aa    MW: 8613.03 Da    PI: 9.717
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10006654mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF991.9e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien++ rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye+ss
  Ciclev10006654m  9 KKIENDTSRQVTFSKRRNGMLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59
                     78***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.198161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-30363IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.58E-39363No hitNo description
PfamPF003193.7E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MVRGKIQMKK IENDTSRQVT FSKRRNGMLK KAYELSVLCD AEVAVIIFSQ KGRLYEFSSS  60
DNQVWVLELA LVLDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19161161Myocyte-specific enhancer factor 2B
1tqe_Q2e-19161161Myocyte-specific enhancer factor 2B
1tqe_R2e-19161161Myocyte-specific enhancer factor 2B
1tqe_S2e-19161161Myocyte-specific enhancer factor 2B
6bz1_A2e-19161161MEF2 CHIMERA
6bz1_B2e-19161161MEF2 CHIMERA
6bz1_C2e-19161161MEF2 CHIMERA
6bz1_D2e-19161161MEF2 CHIMERA
6c9l_A2e-19161161Myocyte-specific enhancer factor 2B
6c9l_B2e-19161161Myocyte-specific enhancer factor 2B
6c9l_C2e-19161161Myocyte-specific enhancer factor 2B
6c9l_D2e-19161161Myocyte-specific enhancer factor 2B
6c9l_E2e-19161161Myocyte-specific enhancer factor 2B
6c9l_F2e-19161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.22012e-86flower
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}.
UniprotTISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}.
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0325325e-97EU032532.1 Citrus sinensis SOC1-like protein 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275771.16e-36SOC1-like protein 2
SwissprotQ9FIS13e-33AGL42_ARATH; MADS-box protein AGL42
TrEMBLV4S8694e-47V4S869_9ROSI; Uncharacterized protein
STRINGXP_006421815.16e-48(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.41e-35AGAMOUS-like 42