![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Ciclev10002736m | ||||||||
Common Name | CICLE_v10002739mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 162aa MW: 17699.9 Da PI: 9.8829 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 82.2 | 1.3e-25 | 3 | 61 | 7 | 65 |
DUF702 7 sCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaa 65 +C+dCGn+ak++C+++RCRtCCk+r fdC+thv+stWvpaakrr++++ + ss++ + Ciclev10002736m 3 ACRDCGNRAKRECSFRRCRTCCKTRRFDCTTHVRSTWVPAAKRRQKKKLITGGSSSSLS 61 7********************************************99888776665544 PP | |||||||
2 | DUF702 | 70.4 | 5.7e-22 | 59 | 129 | 86 | 154 |
DUF702 86 lsstklssaeskkeletsslPeevsseavfrcvrvssvddgee...elaYqtavsigGhvfkGiLydqGlee 154 + s + ++a+ + e+ ++slP +v+++avfrc++v++v+dg++ e++Y ++v+i+GhvfkG+Lyd G++e Ciclev10002736m 59 SLSFS-TTASCQDESFKKSLPGKVQAPAVFRCIKVTAVSDGDDnkaEVGYVATVNISGHVFKGFLYDLGIDE 129 22222.2333444555677*******************88654222799********************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 1.3E-40 | 3 | 128 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 2.6E-23 | 4 | 45 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 8.2E-24 | 77 | 127 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MRACRDCGNR AKRECSFRRC RTCCKTRRFD CTTHVRSTWV PAAKRRQKKK LITGGSSSSL 60 SFSTTASCQD ESFKKSLPGK VQAPAVFRCI KVTAVSDGDD NKAEVGYVAT VNISGHVFKG 120 FLYDLGIDEK KLFPWDSSGR ENKESSPPNV DSSNADATSG N* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006432447.2 | 1e-115 | protein SHI RELATED SEQUENCE 6 | ||||
Swissprot | Q9M2U4 | 3e-46 | SRS6_ARATH; Protein SHI RELATED SEQUENCE 6 | ||||
TrEMBL | A0A067EUM3 | 1e-114 | A0A067EUM3_CITSI; Uncharacterized protein | ||||
TrEMBL | V4T828 | 1e-114 | V4T828_9ROSI; Uncharacterized protein | ||||
STRING | XP_006432446.1 | 1e-115 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11959 | 23 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54430.1 | 1e-32 | SHI-related sequence 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Ciclev10002736m |
Entrez Gene | 18041690 |
Publications ? help Back to Top | |||
---|---|---|---|
|