![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc11_g04550 | ||||||||
Common Name | GSCOC_T00004809001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 96aa MW: 10624.4 Da PI: 10.7153 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 76.8 | 2.7e-24 | 10 | 48 | 24 | 62 |
zf-Dof 24 yslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ysl+qPr+fCk+CrryWtkGGalrnv +Ggg+rknkks+ Cc11_g04550 10 YSLAQPRHFCKTCRRYWTKGGALRNVLIGGGCRKNKKSK 48 9***********************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50884 | 17.541 | 1 | 46 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 4.0E-14 | 10 | 46 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.3E-18 | 10 | 46 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MQFAKHKGFY SLAQPRHFCK TCRRYWTKGG ALRNVLIGGG CRKNKKSKPP SRLTVDPKDT 60 NMTSDIGGLK FFHGLTPAMD FQLGGITSYL LPEGF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027074289.1 | 2e-48 | dof zinc finger protein DOF5.7-like | ||||
Refseq | XP_027180024.1 | 2e-48 | dof zinc finger protein DOF5.7-like | ||||
Swissprot | Q9LSL6 | 1e-20 | DOF57_ARATH; Dof zinc finger protein DOF5.7 | ||||
TrEMBL | A0A068VBC4 | 9e-65 | A0A068VBC4_COFCA; Uncharacterized protein | ||||
STRING | XP_006426240.1 | 1e-38 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5242 | 22 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65590.1 | 6e-23 | Dof family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|