PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

M-type_MADS

Protein Properties

Length: 67aa MW: 7384.59 Da PI: 11.3251

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc10_g08300	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.2	5.3e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev v+ifsstgkly++ss Cc10_g08300 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVVIFSSTGKLYDFSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.0E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.427	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.02E-37	2	60	No hit	No description
SuperFamily	SSF55455	1.44E-28	2	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-29	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.5E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-29	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVVIFSS TGKLYDFSSS 60 RSFTFP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-18	1	60	1	60	MEF2C
5f28_B	1e-18	1	60	1	60	MEF2C
5f28_C	1e-18	1	60	1	60	MEF2C
5f28_D	1e-18	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269\|PubMed:17704216, ECO:0000269\|PubMed:24876250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the micro RNA miR824. {ECO:0000269\|PubMed:18579782}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ483224	4e-97	KJ483224.1 Coffea arabica AGL16 (AGL16) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027149248.1	1e-35	MADS-box transcription factor 27-like isoform X2
Swissprot	A2RVQ5	2e-32	AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBL	A0A068TXG0	2e-39	A0A068TXG0_COFCA; Uncharacterized protein
STRING	cassava4.1_032220m	2e-36	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57230.1	7e-35	AGAMOUS-like 16

Publications ? help Back to Top
Yang K,Jiang M,Le J A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell. J Integr Plant Biol, 2014. 56(6): p. 539-49 [PMID:24386951]