PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

HSF

Protein Properties

Length: 162aa MW: 17682.8 Da PI: 9.4228

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc06_g19040	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	72.2	9.7e-23	80	138	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl k+y+i++++e++++isws++g+sf+v+d+++f +vL kyF+h+nfaSF+ QLn+Y Cc06_g19040 80 FLLKVYDIVKNPETESIISWSSSGTSFIVWDPHRFVAEVLGKYFRHNNFASFICQLNTY 138 9********************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	6.5E-25	71	140	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.6E-20	76	159	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	2.18E-21	78	139	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.0E-12	80	103	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	9.7E-20	80	139	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.0E-12	118	130	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.0E-12	131	143	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MEANQETSEV TNSTKYELKN GENEGERLNP TIPMGTDVSE SSSNAIVTAA TAVSATPLAK 60 EGYANGASSS SSRVRAPPPF LLKVYDIVKN PETESIISWS SSGTSFIVWD PHRFVAEVLG 120 KYFRHNNFAS FICQLNTYVK RSIGIDWNSR MRGSKKGRRV G*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	8e-18	78	143	27	92	Heat shock factor protein 1
5d5v_B	8e-18	78	143	27	92	Heat shock factor protein 1
5d5v_D	8e-18	78	143	27	92	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:16202242}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027174269.1	2e-68	heat stress transcription factor A-2d-like
Swissprot	Q338B0	2e-24	HFA2C_ORYSJ; Heat stress transcription factor A-2c
TrEMBL	A0A068UPI1	1e-115	A0A068UPI1_COFCA; Uncharacterized protein

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA16030	2	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	1e-17	heat shock factor 1

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Singh A, et al. OsHsfA2c and OsHsfB4b are involved in the transcriptional regulation of cytoplasmic OsClpB (Hsp100) gene in rice (Oryza sativa L.). Cell Stress Chaperones, 2012. 17(2): p. 243-54 [PMID:22147560]