PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea

Family

NAC

Protein Properties

Length: 193aa MW: 21940.5 Da PI: 4.8119

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cc02_g21890	genome	CGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	120.2	1.9e-37	8	127	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF Ptdeelv ++L++k++ +++ +vi+++d+y ++PwdL+ k+ ae ++wyf+s+r + +r+t +gyWk g d+++ls+ +g Cc02_g21890 8 LPPGFRFYPTDEELVAHFLHRKAALLPCHP-DVIPDLDLYPYDPWDLDGKAMAEGNKWYFYSRRTQ--------SRITGNGYWKGMGVDEPILSStSG 96 79***********************999.99**********977778899**9854........799************99788 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++ g+k+ vfy g+ ++g+kt+W+m+eyrl Cc02_g21890 97 QKLGMKRCYVFYVGEPSEGVKTNWIMQEYRL 127 99*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.53E-49	6	159	IPR003441	NAC domain
PROSITE profile	PS51005	46.999	8	160	IPR003441	NAC domain
Pfam	PF02365	5.2E-23	9	127	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010089	Biological Process	xylem development
GO:0043067	Biological Process	regulation of programmed cell death
GO:0048367	Biological Process	shoot system development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 193 aa Download sequence Send to blast
MGDNNAKLPP GFRFYPTDEE LVAHFLHRKA ALLPCHPDVI PDLDLYPYDP WDLDGKAMAE 60 GNKWYFYSRR TQSRITGNGY WKGMGVDEPI LSSTSGQKLG MKRCYVFYVG EPSEGVKTNW 120 IMQEYRLSAE NGSSGSSRSS KKRHSKIDYS KWVVCRVYER NCDNDDDDGT ELSCLDEVFL 180 SLDDLDEISL PN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-41	8	161	17	166	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-41	8	161	17	166	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-41	8	161	17	166	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-41	8	161	17	166	NO APICAL MERISTEM PROTEIN
3swm_A	1e-41	8	161	20	169	NAC domain-containing protein 19
3swm_B	1e-41	8	161	20	169	NAC domain-containing protein 19
3swm_C	1e-41	8	161	20	169	NAC domain-containing protein 19
3swm_D	1e-41	8	161	20	169	NAC domain-containing protein 19
3swp_A	1e-41	8	161	20	169	NAC domain-containing protein 19
3swp_B	1e-41	8	161	20	169	NAC domain-containing protein 19
3swp_C	1e-41	8	161	20	169	NAC domain-containing protein 19
3swp_D	1e-41	8	161	20	169	NAC domain-containing protein 19
4dul_A	1e-41	8	161	17	166	NAC domain-containing protein 19
4dul_B	1e-41	8	161	17	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269\|PubMed:18069942, ECO:0000269\|PubMed:20458494}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027106335.1	1e-142	NAC domain-containing protein 104-like
Refseq	XP_027159802.1	1e-142	NAC domain-containing protein 104
Swissprot	Q8GWK6	2e-85	NC104_ARATH; NAC domain-containing protein 104
TrEMBL	A0A068TMB6	1e-141	A0A068TMB6_COFCA; Uncharacterized protein
STRING	XP_009762857.1	1e-109	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA3766	24	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64530.1	2e-74	xylem NAC domain 1

Publications ? help Back to Top
Zhao C, et al. XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED. New Phytol., 2017. 216(1): p. 76-89 [PMID:28742236] Tang N, et al. Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis. Nat Commun, 2018. 9(1): p. 3884 [PMID:30250259]