![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc02_g21890 | ||||||||
Common Name | GSCOC_T00014839001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 193aa MW: 21940.5 Da PI: 4.8119 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 120.2 | 1.9e-37 | 8 | 127 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrF Ptdeelv ++L++k++ +++ +vi+++d+y ++PwdL+ k+ ae ++wyf+s+r + +r+t +gyWk g d+++ls+ +g Cc02_g21890 8 LPPGFRFYPTDEELVAHFLHRKAALLPCHP-DVIPDLDLYPYDPWDLDGKAMAEGNKWYFYSRRTQ--------SRITGNGYWKGMGVDEPILSStSG 96 79*************************999.99**************977778899******9854........799****************99788 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++ g+k+ vfy g+ ++g+kt+W+m+eyrl Cc02_g21890 97 QKLGMKRCYVFYVGEPSEGVKTNWIMQEYRL 127 99***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.53E-49 | 6 | 159 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 46.999 | 8 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.2E-23 | 9 | 127 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MGDNNAKLPP GFRFYPTDEE LVAHFLHRKA ALLPCHPDVI PDLDLYPYDP WDLDGKAMAE 60 GNKWYFYSRR TQSRITGNGY WKGMGVDEPI LSSTSGQKLG MKRCYVFYVG EPSEGVKTNW 120 IMQEYRLSAE NGSSGSSRSS KKRHSKIDYS KWVVCRVYER NCDNDDDDGT ELSCLDEVFL 180 SLDDLDEISL PN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-41 | 8 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-41 | 8 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-41 | 8 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-41 | 8 | 161 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 1e-41 | 8 | 161 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 1e-41 | 8 | 161 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 1e-41 | 8 | 161 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027106335.1 | 1e-142 | NAC domain-containing protein 104-like | ||||
Refseq | XP_027159802.1 | 1e-142 | NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 2e-85 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A068TMB6 | 1e-141 | A0A068TMB6_COFCA; Uncharacterized protein | ||||
STRING | XP_009762857.1 | 1e-109 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3766 | 24 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 2e-74 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|