![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc02_g20220 | ||||||||
Common Name | GSCOC_T00014628001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 206aa MW: 22658.2 Da PI: 10.2416 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 62.5 | 4.9e-20 | 15 | 62 | 2 | 49 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 r + +sn vtfskRr g++KKA+EL +LC+ae+a+i+fs+ k++ y Cc02_g20220 15 RMSKESNLLVTFSKRRSGLFKKAYELHTLCGAEIAIIVFSPGKKVFSY 62 567889999*********************************999988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 23.016 | 6 | 66 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.8E-28 | 6 | 65 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 5.76E-25 | 7 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.35E-31 | 7 | 74 | No hit | No description |
PRINTS | PR00404 | 1.7E-18 | 8 | 28 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.0E-22 | 16 | 62 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-18 | 28 | 43 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-18 | 43 | 64 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009960 | Biological Process | endosperm development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MARKSKGRQK IEMTRMSKES NLLVTFSKRR SGLFKKAYEL HTLCGAEIAI IVFSPGKKVF 60 SYGHPCLYSI IDRFAHRAAS IRELNMQLTE MLNQLDAERK RGEELIKLRT ASQGRCWWEA 120 PVNDLGLQEL EQLKAAMEEL KKNVANQAEK LMVEASNATA FLGSSSSKGG GHVGPSNIDA 180 KVPPPGLGLS MTPHGFALGY GRGFF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3kov_B | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3kov_I | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3kov_J | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3mu6_A | 2e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3mu6_B | 2e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3mu6_C | 2e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3mu6_D | 2e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3p57_A | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3p57_B | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3p57_C | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3p57_D | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3p57_I | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
3p57_J | 3e-15 | 7 | 63 | 1 | 57 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027101457.1 | 1e-140 | agamous-like MADS-box protein AGL62 | ||||
Refseq | XP_027157593.1 | 1e-140 | agamous-like MADS-box protein AGL62 | ||||
Swissprot | Q9FKK2 | 4e-54 | AGL62_ARATH; Agamous-like MADS-box protein AGL62 | ||||
TrEMBL | A0A068TPM5 | 1e-150 | A0A068TPM5_COFCA; Uncharacterized protein | ||||
STRING | XP_006487058.1 | 1e-82 | (Citrus sinensis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA204 | 24 | 223 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 5e-53 | AGAMOUS-like 62 |
Publications ? help Back to Top | |||
---|---|---|---|
|