![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cc01_g20540 | ||||||||
Common Name | GSCOC_T00015920001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 182aa MW: 20004.4 Da PI: 4.98 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 172.2 | 5.7e-54 | 36 | 131 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdr+lPianv+rimk++lPanakisk+aket+qec+sefisfvt+easdkc++ekrkt+ngdd++wal++lGf++y+eplk yl+++relege+ Cc01_g20540 36 KEQDRLLPIANVGRIMKQILPANAKISKEAKETMQECASEFISFVTGEASDKCHKEKRKTVNGDDICWALGSLGFDEYAEPLKRYLNRFRELEGER 131 89*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.6E-53 | 31 | 151 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.42E-41 | 38 | 161 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.9E-27 | 41 | 105 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.8E-19 | 69 | 87 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 72 | 88 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.8E-19 | 88 | 106 | No hit | No description |
PRINTS | PR00615 | 3.8E-19 | 107 | 125 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MVDSIIEGEG EGEALNKYKA SVAAGSGSGD DGMVIKEQDR LLPIANVGRI MKQILPANAK 60 ISKEAKETMQ ECASEFISFV TGEASDKCHK EKRKTVNGDD ICWALGSLGF DEYAEPLKRY 120 LNRFRELEGE RANQNKSGNS EEKVMNQNLA EPRKITTHVS PTSINFNFMD ESSNSLSRSC 180 F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-43 | 35 | 126 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-43 | 35 | 126 | 1 | 92 | Transcription factor HapC (Eurofung) |
5g49_A | 3e-43 | 33 | 126 | 4 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027174014.1 | 1e-122 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 4e-61 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A068U5D1 | 1e-131 | A0A068U5D1_COFCA; Uncharacterized protein | ||||
STRING | XP_010269452.1 | 9e-75 | (Nelumbo nucifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 3e-63 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|