Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GRAS | 411.8 | 6.1e-126 | 241 | 587 | 1 | 360 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkf 93
lv++L++cAeav++++l+la+al++++ la ++ +m+++a+yf+eALa+r++r l pp+++ +++ s++l++ f+e++P+lkf
Carubv10018534m 241 LVHALMACAEAVQQNNLTLAEALVKQIGCLAVSQSGAMRKVATYFAEALARRIYR--------LsPPQNQIDHSLSDTLQM--HFYETCPYLKF 324
689****************************************************........414444444445555444..4********** PP
GRAS 94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
+h+taNqaIlea++g++rvH+iDf+++qGlQWpaL+qaLa R++gpp +R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++ +va++l+
Carubv10018534m 325 AHFTANQAILEAFQGKKRVHVIDFSMNQGLQWPALMQALALREGGPPVFRLTGIGPPAPDNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLA 418
********************************************************************************************** PP
GRAS 188 dleleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
dl+ ++L+++p E++aVn+v++lh+ll +++ +e+ vL +vk+++P +++vveqe++hn++ Fl+rf+e+l+yys+lfdsle s
Carubv10018534m 419 DLDASMLELRPseVESVAVNSVFELHKLLGRPGGIEK----VLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGV---PS 505
***********88899*****************9999....*********************************************998...69 PP
GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvl 360
++++++++++lg++i+n+vaceg +r+erhetl++W +r++++GF p++l+++a kqa++ll+ ++ ++gyrvee++g+l+l
Carubv10018534m 506 SQDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGFAPAHLGSNAFKQASMLLSVFNsGQGYRVEENNGCLIL 587
999*****************************************************************************98 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0009723 | Biological Process | response to ethylene |
GO:0009737 | Biological Process | response to abscisic acid |
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway |
GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway |
GO:0010187 | Biological Process | negative regulation of seed germination |
GO:0010218 | Biological Process | response to far red light |
GO:0042176 | Biological Process | regulation of protein catabolic process |
GO:0042538 | Biological Process | hyperosmotic salinity response |
GO:2000033 | Biological Process | regulation of seed dormancy process |
GO:2000377 | Biological Process | regulation of reactive oxygen species metabolic process |
GO:0005634 | Cellular Component | nucleus |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Stewart Lilley JL,Gan Y,Graham IA,Nemhauser JL
The effects of DELLAs on growth change with developmental stage and brassinosteroid levels. Plant J., 2013. 76(1): p. 165-73 [PMID:23834248] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Oh E, et al.
Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl. Elife, 2015. [PMID:24867218] - Gallego-Giraldo C, et al.
Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis. Plant J., 2014. 79(6): p. 1020-1032 [PMID:24961590] - Fukazawa J, et al.
DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis. Plant Cell, 2014. 26(7): p. 2920-38 [PMID:25035403] - Tan L,Rong W,Luo H,Chen Y,He C
The Xanthomonas campestris effector protein XopDXcc8004 triggers plant disease tolerance by targeting DELLA proteins. New Phytol., 2014. 204(3): p. 595-608 [PMID:25040905] - Urano D,Dong T,Bennetzen JL,Jones AM
Adaptive evolution of signaling partners. Mol. Biol. Evol., 2015. 32(4): p. 998-1007 [PMID:25568345] - Montenegro-Johnson TD, et al.
Digital Single-Cell Analysis of Plant Organ Development Using 3DCellAtlas. Plant Cell, 2015. 27(4): p. 1018-33 [PMID:25901089] - Kim SI, et al.
E3 SUMO ligase AtSIZ1 positively regulates SLY1-mediated GA signalling and plant development. Biochem. J., 2015. 469(2): p. 299-314 [PMID:26008766] - MarĂn-de la Rosa N, et al.
Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] - Xu F, et al.
DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] - Moubayidin L, et al.
A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis. Planta, 2016. 243(5): p. 1159-68 [PMID:26848984] - Xie Y,Tan H,Ma Z,Huang J
DELLA Proteins Promote Anthocyanin Biosynthesis via Sequestering MYBL2 and JAZ Suppressors of the MYB/bHLH/WD40 Complex in Arabidopsis thaliana. Mol Plant, 2016. 9(5): p. 711-721 [PMID:26854848] - Shi H,Wei Y,Wang Q,Reiter RJ,He C
Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis. J. Pineal Res., 2016. 60(3): p. 373-9 [PMID:26887824] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] - Liu B,De Storme N,Geelen D
Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis. Plant Physiol., 2017. 173(1): p. 338-353 [PMID:27621423] - Jiang K, et al.
Substituted Phthalimide AC94377 Is a Selective Agonist of the Gibberellin Receptor GID1. Plant Physiol., 2017. 173(1): p. 825-835 [PMID:27899534] - Matsuoka K, et al.
Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls. Plant Cell Physiol., 2016. 57(12): p. 2620-2631 [PMID:27986917] - Zhang Y, et al.
GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation. Plant Cell Rep., 2017. 36(4): p. 557-569 [PMID:28275852] - Zheng H, et al.
MLK1 and MLK2 Coordinate RGA and CCA1 Activity to Regulate Hypocotyl Elongation in Arabidopsis thaliana. Plant Cell, 2018. 30(1): p. 67-82 [PMID:29255112] - Yamazaki K, et al.
Suppression of DELLA signaling induces procambial cell formation in culture. Plant J., 2018. 94(1): p. 48-59 [PMID:29383774] - Liu B,De Storme N,Geelen D
Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling. Front Plant Sci, 2018. 9: p. 91 [PMID:29459879] - Kumar A,Singh A,Panigrahy M,Sahoo PK,Panigrahi KCS
Carbon nanoparticles influence photomorphogenesis and flowering time in Arabidopsis thaliana. Plant Cell Rep., 2018. 37(6): p. 901-912 [PMID:29541883] - Zhang Y, et al.
DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6. Plant Cell Rep., 2018. 37(7): p. 981-992 [PMID:29574486]
|