![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10015980m | ||||||||
Common Name | CARUB_v10015980mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 110aa MW: 12644.7 Da PI: 8.7364 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 93.5 | 2.5e-29 | 9 | 107 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 +C+ C +++++C+k+C +++yfp e + +++ ++ lFG+ n++k+++++pe+e++++++s++ e++a+++dPv+G +g++++l ++ +ka l Carubv10015980m 9 PCCICITKNKNCPKNCEFSEYFPYELKDQYESANNLFGTPNIIKTMRRAPEKEKQMLATSIIVEGNAWTKDPVRGGFGMVRNLMWKTVLHKAYL 102 7********************************************************************************************9 PP DUF260 95 allke 99 ++l+e Carubv10015980m 103 HELEE 107 99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 19.948 | 8 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.2E-23 | 9 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MEALRKNGPC CICITKNKNC PKNCEFSEYF PYELKDQYES ANNLFGTPNI IKTMRRAPEK 60 EKQMLATSII VEGNAWTKDP VRGGFGMVRN LMWKTVLHKA YLHELEEKN* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10015980m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006299784.2 | 4e-77 | LOW QUALITY PROTEIN: LOB domain-containing protein 8 | ||||
Swissprot | Q9ZUP0 | 3e-54 | LBD8_ARATH; LOB domain-containing protein 8 | ||||
TrEMBL | R0GAE3 | 2e-76 | R0GAE3_9BRAS; Uncharacterized protein | ||||
STRING | XP_006299784.1 | 4e-77 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12282 | 14 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G19510.1 | 1e-56 | LOB domain-containing protein 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10015980m |
Entrez Gene | 17892740 |