![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10015035m | ||||||||
Common Name | CARUB_v10015035mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 74aa MW: 8068.77 Da PI: 10.7779 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 144.1 | 2.7e-45 | 5 | 73 | 2 | 70 |
S1FA 2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 + +k+e+kGlnPGlivllv+ggll++flvgn+ily+yaqknlPPrkkkPvskkk+k+eklkqGv+vPGe Carubv10015035m 5 FSGKIESKGLNPGLIVLLVIGGLLVTFLVGNFILYTYAQKNLPPRKKKPVSKKKMKKEKLKQGVQVPGE 73 5689****************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 6.4E-40 | 9 | 73 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MAEEFSGKIE SKGLNPGLIV LLVIGGLLVT FLVGNFILYT YAQKNLPPRK KKPVSKKKMK 60 KEKLKQGVQV PGE* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10015035m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF380629 | 3e-92 | AF380629.1 Arabidopsis thaliana AT3g09731 mRNA, complete cds. | |||
GenBank | AK118970 | 3e-92 | AK118970.1 Arabidopsis thaliana At3g09735 mRNA for unknown protein, complete cds, clone: RAFL21-30-H15. | |||
GenBank | AY054129 | 3e-92 | AY054129.1 Arabidopsis thaliana AT3g09731 mRNA, complete cds. | |||
GenBank | AY087186 | 3e-92 | AY087186.1 Arabidopsis thaliana clone 32612 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006298914.1 | 9e-44 | DNA-binding protein S1FA3 | ||||
Swissprot | Q42337 | 3e-18 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | R0G851 | 2e-42 | R0G851_9BRAS; Uncharacterized protein | ||||
STRING | XP_006298914.1 | 3e-43 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2823 | 27 | 69 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G09735.1 | 2e-09 | S1FA-like DNA-binding protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10015035m |
Entrez Gene | 17893751 |