PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10010717m | ||||||||
Common Name | CARUB_v10010717mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 104aa MW: 12227.3 Da PI: 10.0189 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.2 | 3.3e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+ eEd+ll ++++++G ++W++ ++ g+ R++k+c++rw +yl Carubv10010717m 14 KGPWSGEEDQLLTNYITLHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61 79******************************99************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 20.342 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.1E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 8.98E-22 | 15 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.26E-9 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-7 | 65 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MGRRPCCEKT GLKKGPWSGE EDQLLTNYIT LHGHPNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TSLEEDTIIH LHHILGNRFL LLLFSRIYER YYF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-14 | 12 | 89 | 5 | 81 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269|PubMed:16861809, ECO:0000269|PubMed:9681014}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10010717m |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269|PubMed:9681014}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493437 | 3e-90 | AB493437.1 Arabidopsis thaliana At1g06180 mRNA for hypothetical protein, partial cds, clone: RAAt1g06180. | |||
GenBank | AY519550 | 3e-90 | AY519550.1 Arabidopsis thaliana MYB transcription factor (At1g06180) mRNA, complete cds. | |||
GenBank | BT025173 | 3e-90 | BT025173.1 Arabidopsis thaliana At1g06180 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006303456.2 | 1e-61 | transcription factor MYB13 | ||||
Swissprot | Q9LNC9 | 3e-53 | MYB13_ARATH; Transcription factor MYB13 | ||||
TrEMBL | R0I279 | 6e-70 | R0I279_9BRAS; Uncharacterized protein | ||||
STRING | XP_006303456.1 | 1e-70 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06180.1 | 1e-55 | myb domain protein 13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10010717m |
Entrez Gene | 17899527 |
Publications ? help Back to Top | |||
---|---|---|---|
|