![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10006405m | ||||||||
Common Name | CARUB_v10006405mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 136aa MW: 15879 Da PI: 10.6656 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47.3 | 4.7e-15 | 20 | 63 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT Ed +l ++v+ G+ W+ I + m+ gRt+k c+srw++yl Carubv10006405m 20 WTSLEDSKLRELVAVSGPQKWSHIGKQMQ-GRTGKTCRSRWFNYL 63 *****************************.**************7 PP | |||||||
2 | Myb_DNA-binding | 39.8 | 1e-12 | 69 | 110 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +++++ eE e+l++a+k+lG++ W++Ia+++ gRt+ + + Carubv10006405m 69 KDAFSDEENEKLLKAHKELGNK-WSRIAKRFH-GRTDRAVHKQF 110 679*******************.*********.****9886655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.665 | 12 | 67 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.21E-25 | 15 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.9E-10 | 16 | 65 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-24 | 19 | 70 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.2E-13 | 20 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.97E-9 | 20 | 63 | No hit | No description |
PROSITE profile | PS51294 | 13.042 | 68 | 118 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-11 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-10 | 69 | 110 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.23E-6 | 71 | 114 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.3E-19 | 71 | 119 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
RPLNEVREEE KNKDRQSKLW TSLEDSKLRE LVAVSGPQKW SHIGKQMQGR TGKTCRSRWF 60 NYLDPKINKD AFSDEENEKL LKAHKELGNK WSRIAKRFHG RTDRAVHKQF DKLMRRELKK 120 PSSASPHDPN DKAEG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 5e-28 | 20 | 118 | 7 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269|PubMed:19542355}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10006405m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006282491.2 | 2e-96 | transcription factor MYB105 | ||||
Swissprot | Q9SEZ4 | 1e-34 | MY105_ARATH; Transcription factor MYB105 | ||||
TrEMBL | R0GF62 | 2e-94 | R0GF62_9BRAS; Uncharacterized protein (Fragment) | ||||
STRING | XP_006282491.1 | 3e-95 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM19099 | 5 | 7 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G29020.1 | 4e-43 | myb domain protein 110 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10006405m |
Entrez Gene | 17878888 |
Publications ? help Back to Top | |||
---|---|---|---|
|