![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10003623m | ||||||||
Common Name | CARUB_v10003623mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 24343 Da PI: 6.8071 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 21.5 | 5.4e-07 | 5 | 47 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44 WT Ed+ + +a +++ g +W++Ia + +++ ++++++ Carubv10003623m 5 QWTRSEDKMFEQALVLFPEGspnRWERIADQLH--KSAGEVREHY 47 7*******************************7..9********9 PP | |||||||
2 | Myb_DNA-binding | 43 | 1.1e-13 | 99 | 143 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+ E++l++ + k++G+g+W++I+r + +Rt+ q+ s+ qky Carubv10003623m 99 PWTENEHKLFLIGLKRYGKGDWRSISRNVVVTRTPTQVASHAQKY 143 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 8.431 | 1 | 55 | IPR017930 | Myb domain |
SMART | SM00717 | 1.6E-7 | 2 | 53 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.87E-12 | 4 | 58 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.4E-5 | 5 | 48 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.27E-6 | 6 | 51 | No hit | No description |
PROSITE profile | PS51294 | 18.261 | 92 | 148 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.44E-16 | 94 | 149 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.7E-16 | 95 | 147 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 7.0E-9 | 96 | 146 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-10 | 98 | 142 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.7E-11 | 99 | 143 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.80E-8 | 99 | 144 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MASSQWTRSE DKMFEQALVL FPEGSPNRWE RIADQLHKSA GEVREHYEAL VHDVFEIDAG 60 RVDVPDYMDD SAAAAGWDSA GQISFGSKHG ESERKRGTPW TENEHKLFLI GLKRYGKGDW 120 RSISRNVVVT RTPTQVASHA QKYFLRQNSV KKERKRSSIH DITTVDTNLA MPGSNMDWTG 180 QHGSPVQPPQ QQQLLSEFGQ QLNPGHFEDF GFRM* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00055 | PBM | Transfer from AT5G04760 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10003623m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY050976 | 0.0 | AY050976.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds. | |||
GenBank | AY088362 | 0.0 | AY088362.1 Arabidopsis thaliana clone 6170 mRNA, complete sequence. | |||
GenBank | AY091177 | 0.0 | AY091177.1 Arabidopsis thaliana putative I-box binding factor (At5g04760) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006289993.1 | 1e-160 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 1e-57 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | R0FLN3 | 1e-159 | R0FLN3_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.5249s0014.1.p | 1e-160 | (Capsella grandiflora) | ||||
STRING | XP_006289993.1 | 1e-160 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5127 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-132 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10003623m |
Entrez Gene | 17883647 |
Publications ? help Back to Top | |||
---|---|---|---|
|