 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Carubv10003403m |
| Common Name | CARUB_v10003403mg |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
| Family |
MYB_related |
| Protein Properties |
Length: 78aa MW: 8955.14 Da PI: 5.1684 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Carubv10003403m | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 30.6 | 7.7e-10 | 32 | 71 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
++++eE++l + +k+ G + W +Ia +++ gRt++++ +w
Carubv10003403m 32 NMSQEEEDLVCRMHKLVGDR-WGLIAGRIP-GRTAEEIERFW 71
689***************99.*********.*********99 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AY519522 | 2e-78 | AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds. |
| Publications
? help Back to Top |
- Koiwa H, et al.
C-terminal domain phosphatase-like family members (AtCPLs) differentially regulate Arabidopsis thaliana abiotic stress signaling, growth, and development.
Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10893-8
[PMID:12149434] - Nemie-Feyissa D,Olafsdottir SM,Heidari B,Lillo C
Nitrogen depletion and small R3-MYB transcription factors affecting anthocyanin accumulation in Arabidopsis leaves.
Phytochemistry, 2014. 98: p. 34-40
[PMID:24388610] - Wada T,Tominaga-Wada R
CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
Plant Sci., 2015. 241: p. 260-5
[PMID:26706076] - Tominaga-Wada R,Wada T
The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis.
J. Plant Physiol., 2016. 199: p. 111-115
[PMID:27302012] - Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
Plant J., 2016. 88(5): p. 762-774
[PMID:27496682] - Tominaga-Wada R,Wada T
Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
Development, 2017. 144(13): p. 2375-2380
[PMID:28676568] - Huang KC,Lin WC,Cheng WH
Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
BMC Plant Biol., 2018. 18(1): p. 40
[PMID:29490615]
|
