PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Carubv10001816m | ||||||||
Common Name | CARUB_v10001433mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 247aa MW: 28606.9 Da PI: 10.4935 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.4 | 1.6e-18 | 45 | 92 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw +yl Carubv10001816m 45 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNYL 92 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.5 | 2.4e-16 | 98 | 143 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l Carubv10001816m 98 RGKFNLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 143 899*******************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.4E-26 | 36 | 94 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.705 | 40 | 92 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.36E-31 | 42 | 139 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 7.2E-16 | 44 | 94 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.7E-17 | 45 | 92 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.27E-11 | 47 | 92 | No hit | No description |
PROSITE profile | PS51294 | 25.25 | 93 | 147 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-26 | 95 | 148 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.9E-16 | 97 | 145 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-15 | 98 | 143 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.47E-10 | 100 | 143 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000902 | Biological Process | cell morphogenesis | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MYETLQLTFL HIFLFCSVIR LVYYSLAFGR KMGRSPCCDK LGLKKGPWTP EEDQKLLAYI 60 EEHGHGSWRS LPEKAGLHRC GKSCRLRWTN YLRPDIKRGK FNLQEEQTII QLHALLGNRW 120 SAIATHLPKR TDNEIKNYWN THLKKRLVKM GIDPVTHKPK NETPLSSLGL SKNAAILSHT 180 AQWESARLEA EARLARESKL LHLQHYQTKA SSHHHHHHHG FTHKSLLTNW TTKTNEGKQK 240 KNTHTH* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-26 | 43 | 147 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the control of epidermal cell morphogenesis in petals. Promotes unidirectional cell expansion once outgrowth has been initiated (PubMed:17376813). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). Functions as a major regulator of cuticle formation in vegetative organs by regulating the cuticle biosynthesis genes CYP86A8/LCR and CER1 (PubMed:24169067). {ECO:0000269|PubMed:17376813, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Carubv10001816m |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228474 | 0.0 | AK228474.1 Arabidopsis thaliana mRNA for myb-related protein - like, complete cds, clone: RAFL15-07-O19. | |||
GenBank | X99809 | 0.0 | X99809.1 A.thaliana mRNA for Mixta protein. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023636800.1 | 1e-176 | transcription factor MYB16 isoform X1 | ||||
Swissprot | Q9LXF1 | 1e-144 | MYB16_ARATH; Transcription factor MYB16 | ||||
TrEMBL | R0HBP0 | 0.0 | R0HBP0_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.1036s0022.1.p | 1e-173 | (Capsella grandiflora) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15310.1 | 1e-127 | myb domain protein 16 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Carubv10001816m |
Entrez Gene | 17881109 |
Publications ? help Back to Top | |||
---|---|---|---|
|