![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.4395s0089.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 143aa MW: 16061.8 Da PI: 7.5092 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 163.5 | 2.9e-51 | 2 | 97 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 +++dr+lPianv+r+mk++lP+nakisk+ak+tvqec++efisfvt+easdkc+re+rkt+ngdd++wal+tlG+++y++++ +l+kyre+ Cagra.4395s0089.1.p 2 TDEDRLLPIANVGRLMKQILPSNAKISKEAKQTVQECATEFISFVTCEASDKCHRENRKTVNGDDIWWALSTLGLDNYADAVGRHLHKYREA 93 689***************************************************************************************** PP NF-YB 94 egek 97 e+e+ Cagra.4395s0089.1.p 94 ERER 97 *997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.9E-48 | 2 | 120 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.49E-38 | 4 | 116 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-25 | 7 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.9E-16 | 35 | 53 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 38 | 54 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.9E-16 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 3.9E-16 | 73 | 91 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MTDEDRLLPI ANVGRLMKQI LPSNAKISKE AKQTVQECAT EFISFVTCEA SDKCHRENRK 60 TVNGDDIWWA LSTLGLDNYA DAVGRHLHKY REAERERAEH NKGSNTDSGN EKEPNTRSDL 120 QNQSTKFVRV VEKGSSSTPR LN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-39 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-39 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.4395s0089.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | F7G19 | 0.0 | AC000106.1 Sequence of BAC F7G19 from Arabidopsis thaliana chromosome 1, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006304477.1 | 1e-104 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O04027 | 5e-96 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | R0IG98 | 1e-102 | R0IG98_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.4395s0089.1.p | 1e-103 | (Capsella grandiflora) | ||||
STRING | XP_006304477.1 | 1e-103 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 2e-98 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.4395s0089.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|