PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.2248s0020.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 180aa MW: 20624.8 Da PI: 9.215 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.7 | 1.5e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s Cagra.2248s0020.1.p 9 KRIENVTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQNGRLYDFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 48.4 | 4.1e-17 | 83 | 145 | 9 | 71 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKne 71 ++e+ ++l++e+a + ++i+ Lq R+++G+dL+s+s++eL++L q+eksl+ +Rs+K + Cagra.2248s0020.1.p 83 QKEQYVQELKREMAIMVNKIDHLQLHCRRVMGQDLDSCSVEELKELTIQIEKSLTIVRSRKPR 145 678889******************999**********************************75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 5.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.581 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.57E-31 | 3 | 87 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 4.22E-40 | 3 | 70 | No hit | No description |
PRINTS | PR00404 | 1.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.1E-14 | 86 | 146 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 8.7 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MVRGKIEIKR IENVTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ NGRLYDFASS 60 DMTKIMERYE IYRRESFAAE RLQKEQYVQE LKREMAIMVN KIDHLQLHCR RVMGQDLDSC 120 SVEELKELTI QIEKSLTIVR SRKPRNVQES DHKSAASCGS GNMDISDVKT DLFIGLPES* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3mu6_A | 4e-20 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_B | 4e-20 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_C | 4e-20 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3mu6_D | 4e-20 | 3 | 72 | 2 | 71 | Myocyte-specific enhancer factor 2A |
5f28_A | 7e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_B | 7e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_C | 7e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_D | 7e-20 | 1 | 72 | 1 | 72 | MEF2C |
6byy_A | 8e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_B | 8e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_C | 8e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_D | 8e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_A | 9e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_B | 9e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_C | 9e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_D | 9e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.2248s0020.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189309 | 3e-66 | AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023633792.1 | 1e-121 | MADS-box protein AGL71 | ||||
Swissprot | Q9FLH5 | 2e-66 | AGL72_ARATH; MADS-box protein AGL72 | ||||
TrEMBL | R0F2Y0 | 1e-128 | R0F2Y0_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.2248s0020.1.p | 1e-129 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM8805 | 12 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51860.2 | 1e-70 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.2248s0020.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|