![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.2213s0001.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 165aa MW: 18639.3 Da PI: 9.9712 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 174 | 4.3e-54 | 16 | 142 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk Cagra.2213s0001.1.p 16 LPPGFRFHPTDEELVVHYLKKKATSVPLPV-SIIAEIDLYKFDPWELPSKASFGEHEWYFFSPRDRKYPNGVRPNRAATSGYWKATGTDK 104 79****************************.89***************9888999*********************************** PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++ ++++vg+kk Lvfy g+ pkg ktdW+mheyrl Cagra.2213s0001.1.p 105 PIFTCNSHKVGVKKALVFYGGKPPKGIKTDWIMHEYRL 142 ************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-61 | 7 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.3 | 16 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.2E-28 | 17 | 142 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MENMGDSSIG PGHPHLPPGF RFHPTDEELV VHYLKKKATS VPLPVSIIAE IDLYKFDPWE 60 LPSKASFGEH EWYFFSPRDR KYPNGVRPNR AATSGYWKAT GTDKPIFTCN SHKVGVKKAL 120 VFYGGKPPKG IKTDWIMHEY RLTDGNLSNT AKPPDIATTR KNSLR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swm_B | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swm_C | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swm_D | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swp_A | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swp_B | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swp_C | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
3swp_D | 4e-65 | 16 | 155 | 20 | 158 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00058 | PBM | Transfer from AT1G61110 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.2213s0001.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY087839 | 0.0 | AY087839.1 Arabidopsis thaliana clone 38858 mRNA, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006300981.1 | 1e-121 | NAC transcription factor 25 | ||||
Swissprot | Q8GY42 | 1e-117 | NAC25_ARATH; NAC transcription factor 25 | ||||
TrEMBL | R0HVK8 | 1e-119 | R0HVK8_9BRAS; Uncharacterized protein | ||||
STRING | XP_006300981.1 | 1e-120 | (Capsella rubella) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM190 | 28 | 276 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 1e-120 | NAC domain containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.2213s0001.1.p |