![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.19206s0001.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 108aa MW: 12082.8 Da PI: 6.0823 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 96.1 | 3.7e-30 | 5 | 102 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 +Ca+Ck+l+ +C++ C+ p+fp+++ +f+ vh++FGa+nv+k+l++l eere+a+++l+y Aear rdPv+G++g+ l++++ l+ Cagra.19206s0001.1.p 5 RCAVCKILNVTCEPTCICKPHFPSNS-TRFQDVHQIFGAENVHKILNSLGAEEREIAANCLCYAAEARRRDPVSGVYGMKLHYESILND 92 6**********************987.89************************************************************ PP DUF260 90 lkaelallke 99 +++e++++ + Cagra.19206s0001.1.p 93 VEQEIKSALN 102 ***9988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 21.261 | 4 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.6E-28 | 5 | 99 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
MASNRCAVCK ILNVTCEPTC ICKPHFPSNS TRFQDVHQIF GAENVHKILN SLGAEEREIA 60 ANCLCYAAEA RRRDPVSGVY GMKLHYESIL NDVEQEIKSA LNELETNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-20 | 2 | 104 | 8 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-20 | 2 | 104 | 8 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.19206s0001.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254591 | 1e-167 | AC254591.1 Capsella rubella clone CAP08-M12, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006282797.1 | 2e-72 | LOB domain-containing protein 32 | ||||
Swissprot | O49651 | 7e-41 | LBD32_ARATH; LOB domain-containing protein 32 | ||||
TrEMBL | R0GTP6 | 5e-71 | R0GTP6_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.19206s0001.1.p | 2e-75 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4525 | 14 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22700.1 | 3e-43 | LOB domain-containing protein 32 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.19206s0001.1.p |