PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

MIKC_MADS

Protein Properties

Length: 257aa MW: 29931.4 Da PI: 9.2419

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.1508s0081.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	78.3	5.6e-25	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ ++rqvtf+kRr+ ++KKA+ELSvLCd+ +iifs +++ly+++s Cagra.1508s0081.1.p 9 KRIEDRIRRQVTFAKRRKSLMKKAHELSVLCDVHLGLIIFSYSNRLYDFCS 59 79***********************************************96 PP
2	K-box	44.3	7.6e-16	93	165	13	85
K-box 13 kaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 + +++ + + + +eienL+ ++ + G +L+ L++ +L + e +Le+sl+++R++K e++ +qi++l+ k k Cagra.1508s0081.1.p 93 QCSNCAKTKETMMREIENLKINLQLYDGHGLNLLTYDDLLRFELHLESSLQHVRARKCEFMQQQINKLKGKAK 165 5566777788999********************************************************9976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	26.338	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.9E-30	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.26E-36	2	80	No hit	No description
SuperFamily	SSF55455	1.03E-25	3	85	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.9E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.9E-23	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	10.547	94	207	IPR002487	Transcription factor, K-box
Pfam	PF01486	8.0E-11	97	165	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0030308	Biological Process	negative regulation of cell growth
GO:0048510	Biological Process	regulation of timing of transition from vegetative to reproductive phase
GO:0048530	Biological Process	fruit morphogenesis
GO:0080060	Biological Process	integument development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 257 aa Download sequence Send to blast
MRKGKVVIKR IEDRIRRQVT FAKRRKSLMK KAHELSVLCD VHLGLIIFSY SNRLYDFCSN 60 TTSMENLIMR YQKEKEAGHT HTSADHSFHP ADQCSNCAKT KETMMREIEN LKINLQLYDG 120 HGLNLLTYDD LLRFELHLES SLQHVRARKC EFMQQQINKL KGKAKCTLYI SVFNTKLQQG 180 GSSWEQLMWQ AERQMMTTCQ IQDNDDVTRR QVKKEFLLFD REEEEHHQLI IGALQLVQLP 240 QPSPQPARNQ GPLSGP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
1tqe_Q	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
1tqe_R	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
1tqe_S	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
5f28_A	8e-17	1	85	1	83	MEF2C
5f28_B	8e-17	1	85	1	83	MEF2C
5f28_C	8e-17	1	85	1	83	MEF2C
5f28_D	8e-17	1	85	1	83	MEF2C
6c9l_A	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_B	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_C	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_D	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_E	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
6c9l_F	7e-17	1	85	1	83	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269\|PubMed:20088901, ECO:0000269\|PubMed:20598091, ECO:0000269\|PubMed:27233529}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00172	DAP	Transfer from AT1G31140	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.1508s0081.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006306362.2	1e-177	agamous-like MADS-box protein AGL63
Swissprot	Q9SA07	7e-99	AGL63_ARATH; Agamous-like MADS-box protein AGL63
TrEMBL	A0A2H4FR43	1e-176	A0A2H4FR43_9BRAS; MADS-box transcription factor AGL63
STRING	Cagra.1508s0081.1.p	0.0	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16860	9	10

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G31140.2	1e-101	GORDITA

Link Out ? help Back to Top
Phytozome	Cagra.1508s0081.1.p

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529]