PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

MYB_related

Protein Properties

Length: 219aa MW: 25091.2 Da PI: 9.1737

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.1317s0038.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.5	6.2e-18	42	87	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ Cagra.1317s0038.1.p 42 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 87 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50090	4.646	1	36	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	6.6E-10	22	48	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.46E-22	22	92	IPR009057	Homeodomain-like
PROSITE profile	PS51294	27.814	37	91	IPR017930	Myb domain
SMART	SM00717	2.2E-17	41	89	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-16	42	86	IPR001005	SANT/Myb domain
CDD	cd00167	1.59E-12	44	87	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.0E-21	49	88	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009723	Biological Process	response to ethylene
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010200	Biological Process	response to chitin
GO:0046686	Biological Process	response to cadmium ion
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 219 aa Download sequence Send to blast
MGFCSESFRF EGGGRNIRIG LNRTGKSCRL RWVNYLHPGL KRGKMTPQEE RLVLELHAKW 60 GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKKRPMSP TSSSSNCCSS SMTTTTTHDT 120 GGSNGKMNQE FEDGYYSMDD IWREIDQSGA NIIKPVKDMY YSEQSCYLNF PPPASPTWES 180 SLESIWNMDA DESKMSSFAI DQFPLSFEHG RSSWSSLV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	2e-18	23	91	37	105	MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.1317s0038.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ075253	0.0	DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023633464.1	1e-164	transcription factor MYB59 isoform X2
Swissprot	Q4JL84	1e-125	MYB59_ARATH; Transcription factor MYB59
TrEMBL	V4KWJ1	1e-141	V4KWJ1_EUTSA; Uncharacterized protein
STRING	Cagra.1317s0038.1.p	1e-163	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2502	27	74

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.2	1e-123	myb domain protein 59

Link Out ? help Back to Top
Phytozome	Cagra.1317s0038.1.p

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]