PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0483s0006.1.p
Organism
Capsella grandiflora
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 147aa    MW: 16753.9 Da    PI: 5.3866
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0483s0006.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.7e-142583563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                         ++ +r+++NRe+ArrsR RK++++  L ++v +L++ N +  ++++e +k++a+++s++
  Cagra.0483s0006.1.p 25 RKRKRMISNRESARRSRMRKQKQLGDLINEVTVLKNDNAKITDQVDEASKKYAEMESKN 83
                         6789*****************************************************98 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-162185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.7492386IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-122580No hitNo description
PfamPF001704.0E-132583IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-122576No hitNo description
CDDcd147023.21E-162677No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MGSLQRQTSP ESDNDPRYAS VTDERKRKRM ISNRESARRS RMRKQKQLGD LINEVTVLKN  60
DNAKITDQVD EASKKYAEME SKNNVLRAQA LELTDRLRSL NSVLEMVEEI SGQALDIPEI  120
PESMQNPWQL PCPMQPIRAS ADMFDC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12445RKRKRMISNRESARRSRMRKQK
23744RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCagra.0483s0006.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4006201e-177AF400620.1 Arabidopsis thaliana transcription factor-like protein bZIP53 mRNA, complete cds.
GenBankAL1625071e-177AL162507.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T12C14.
GenBankAY0509231e-177AY050923.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBankAY0914211e-177AY091421.1 Arabidopsis thaliana putative bZIP transcription factor (At3g62420) mRNA, complete cds.
GenBankCP0026861e-177CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023638055.11e-103bZIP transcription factor 53
SwissprotQ9LZP81e-99BZP53_ARATH; bZIP transcription factor 53
TrEMBLR0H8841e-102R0H884_9BRAS; Uncharacterized protein
STRINGCagra.0483s0006.1.p1e-103(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-102basic region/leucine zipper motif 53
Publications ? help Back to Top
  1. Restovic F,Espinoza-Corral R,Gómez I,Vicente-Carbajosa J,Jordana X
    An active Mitochondrial Complex II Present in Mature Seeds Contains an Embryo-Specific Iron-Sulfur Subunit Regulated by ABA and bZIP53 and Is Involved in Germination and Seedling Establishment.
    Front Plant Sci, 2017. 8: p. 277
    [PMID:28293251]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  3. Jain P, et al.
    A-ZIP53, a dominant negative reveals the molecular mechanism of heterodimerization between bZIP53, bZIP10 and bZIP25 involved in Arabidopsis seed maturation.
    Sci Rep, 2017. 7(1): p. 14343
    [PMID:29084982]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]