![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cagra.0463s0005.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 134aa MW: 14921.8 Da PI: 4.7046 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.1 | 3.6e-17 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd ll +++ ++G g W++++ + g++R++k+c++rw +yl Cagra.0463s0005.1.p 10 KGAWTAEEDTLLRQCIDKYGEGKWNLVPLRAGLNRCRKSCRLRWVNYL 57 79********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 24.779 | 5 | 61 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-22 | 5 | 60 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-14 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-16 | 10 | 57 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.39E-22 | 11 | 84 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.30E-11 | 12 | 57 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 7.9E-7 | 61 | 84 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MEGSSKALKK GAWTAEEDTL LRQCIDKYGE GKWNLVPLRA GLNRCRKSCR LRWVNYLNPN 60 INRGEFSSDE VDLLIRLHKL LGNRLLEESQ KADVAGNVGI TIDEEEDTSS IDSMSSTFEK 120 LGSLFNVDTG EVD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-13 | 8 | 87 | 5 | 83 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Cagra.0463s0005.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018444376.1 | 4e-47 | PREDICTED: transcription factor MYB114-like isoform X2 | ||||
Swissprot | Q9FNV9 | 1e-41 | MY113_ARATH; Transcription factor MYB113 | ||||
TrEMBL | A0A089G5X7 | 3e-45 | A0A089G5X7_BRACM; Anthocyanin R2R3-MYB transcription factor | ||||
TrEMBL | A0A0H3XWN6 | 6e-45 | A0A0H3XWN6_RAPSA; Anthocyanin regulator | ||||
STRING | Cagra.0463s0005.1.p | 1e-92 | (Capsella grandiflora) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G66370.1 | 6e-44 | myb domain protein 113 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cagra.0463s0005.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|