PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella

Family

NAC

Protein Properties

Length: 279aa MW: 31705.7 Da PI: 8.6795

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cagra.0202s0012.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	161.4	3.5e-50	21	144	3	128
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 pGfrFhPtdeel+ +yL++kve+k+++l e ik++diyk++PwdLp+ + +ekewyfF+ r +ky+++ r+nr+t sg+Wkatg dk+v Cagra.0202s0012.1.p 21 PGFRFHPTDEELLGYYLRRKVENKPIKL-ELIKQIDIYKFDPWDLPRVSSVGEKEWYFFCMRGRKYRNSVRPNRVTGSGFWKATGIDKPV 109 9*************************.99***********7777799********************************* PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +s + vglkk+Lv+y g+a kg+ktdW+mhe+rl Cagra.0202s0012.1.p 110 YS-NLDCVGLKKSLVYYLGSAGKGTKTDWMMHEFRL 144 .9999***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	53.535	19	168	IPR003441	NAC domain
SuperFamily	SSF101941	2.48E-56	20	167	IPR003441	NAC domain
Pfam	PF02365	1.6E-25	21	144	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005992	Biological Process	trehalose biosynthetic process
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006561	Biological Process	proline biosynthetic process
GO:0009718	Biological Process	anthocyanin-containing compound biosynthetic process
GO:0010120	Biological Process	camalexin biosynthetic process
GO:0042538	Biological Process	hyperosmotic salinity response
GO:1900056	Biological Process	negative regulation of leaf senescence
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 279 aa Download sequence Send to blast
MSGEGKLGRD HHEEEGDAPL PGFRFHPTDE ELLGYYLRRK VENKPIKLEL IKQIDIYKFD 60 PWDLPRVSSV GEKEWYFFCM RGRKYRNSVR PNRVTGSGFW KATGIDKPVY SNLDCVGLKK 120 SLVYYLGSAG KGTKTDWMMH EFRLPSTSKT DSPALQAEVW TLCRIFKRVT SHRNPTIVPP 180 NRKPVITLTD SCSKTSSLDS DHTSHRVVDS LPLSHEPPLQ PHTPYWNQHA VGFNQPTYTC 240 NDNNNFLSFW NVNGTAGFIG DSASWDELRS VIDGNTKP*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	6e-54	21	174	19	171	NO APICAL MERISTEM PROTEIN
1ut4_B	6e-54	21	174	19	171	NO APICAL MERISTEM PROTEIN
1ut7_A	6e-54	21	174	19	171	NO APICAL MERISTEM PROTEIN
1ut7_B	6e-54	21	174	19	171	NO APICAL MERISTEM PROTEIN
3swm_A	7e-54	21	174	22	174	NAC domain-containing protein 19
3swm_B	7e-54	21	174	22	174	NAC domain-containing protein 19
3swm_C	7e-54	21	174	22	174	NAC domain-containing protein 19
3swm_D	7e-54	21	174	22	174	NAC domain-containing protein 19
3swp_A	7e-54	21	174	22	174	NAC domain-containing protein 19
3swp_B	7e-54	21	174	22	174	NAC domain-containing protein 19
3swp_C	7e-54	21	174	22	174	NAC domain-containing protein 19
3swp_D	7e-54	21	174	22	174	NAC domain-containing protein 19
4dul_A	6e-54	21	174	19	171	NAC domain-containing protein 19
4dul_B	6e-54	21	174	19	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00310	DAP	Transfer from AT2G43000	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Cagra.0202s0012.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493587	0.0	AB493587.1 Arabidopsis thaliana At2g43000 mRNA for hypothetical protein, partial cds, clone: RAAt2g43000.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006294694.2	0.0	transcription factor JUNGBRUNNEN 1
Swissprot	Q9SK55	0.0	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	R0FX78	0.0	R0FX78_9BRAS; Uncharacterized protein
STRING	Cagra.0202s0012.1.p	0.0	(Capsella grandiflora)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM306	28	200

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	0.0	NAC domain containing protein 42

Link Out ? help Back to Top
Phytozome	Cagra.0202s0012.1.p

Publications ? help Back to Top
Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]