|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Cagra.0149s0005.1.p |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
|
Family |
Dof |
Protein Properties |
Length: 104aa MW: 11865.6 Da PI: 10.0627 |
Description |
Dof family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Cagra.0149s0005.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 92.6 | 3.1e-29 | 54 | 97 | 2 | 45 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGa 45
++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG
Cagra.0149s0005.1.p 54 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGV 97
68999*************************************96 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated |
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance |
GO:0003677 | Molecular Function | DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC002341 | 3e-90 | AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence. |
GenBank | AK221308 | 3e-90 | AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19. |
GenBank | BT010496 | 3e-90 | BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds. |
GenBank | CP002685 | 3e-90 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |