PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG032871.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 171aa MW: 19332 Da PI: 4.5293 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 80.5 | 3.5e-25 | 14 | 136 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk.dkevlsk 95 +G+rF Ptd++lvv+yLk+k+ g++l+ ++i+++d+y + P +Lp ++ + ++ew+fFs+++k +++ gy + +++ CCG032871.1 14 VAGYRFCPTDDDLVVYYLKRKILGEQLPG-NIIPTTDVYASSPDKLPlGlfRM-GMDNEWFFFSTKSKDD-----DITVVDGGYYEIDPDgAAPITW- 103 58***************************.89***************534444.3578*******98864.....4557889999955442677877. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+ vg ktL f +g+ p+g++t+W+++e+r+ CCG032871.1 104 EGKIVGHVKTLFFCRGSPPNGTETEWMVEEFRV 136 999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.24E-32 | 10 | 164 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 30.435 | 13 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.2E-15 | 15 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MSSGEQVLAV PAVVAGYRFC PTDDDLVVYY LKRKILGEQL PGNIIPTTDV YASSPDKLPL 60 GLFRMGMDNE WFFFSTKSKD DDITVVDGGY YEIDPDGAAP ITWEGKIVGH VKTLFFCRGS 120 PPNGTETEWM VEEFRVNPEF FPVDKADHTT QEKITNLVVC KIYRMRPPPE R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-16 | 16 | 171 | 20 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-16 | 16 | 171 | 20 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-16 | 16 | 171 | 20 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-16 | 16 | 171 | 20 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-16 | 16 | 171 | 23 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-16 | 16 | 171 | 20 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-16 | 16 | 171 | 20 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011011746.1 | 1e-125 | PREDICTED: NAC domain-containing protein 86-like | ||||
TrEMBL | A0A2K2ATE1 | 1e-102 | A0A2K2ATE1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0004s11840.1 | 1e-90 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14452 | 7 | 18 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G17260.1 | 7e-23 | NAC domain containing protein 86 |