![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG031566.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 255aa MW: 28975.8 Da PI: 9.3492 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 167.5 | 4.6e-52 | 14 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk+++++ ++ CCG031566.1 14 LPPGFRFHPTDEELVVQYLKRKVFACPLPA-SIIPEVDVCKSDPWDLPGD---LEQERYFFSTREAKYPNGNRSNRATGSGYWKATGIDKQIVTSkGN 107 79****************************.89***************54...46799*********************************9988577 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 ++vg+kktLvfy+g+ p+g++tdW+mheyrl CCG031566.1 108 QAVGMKKTLVFYRGKPPHGTRTDWIMHEYRL 138 78***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.58E-60 | 10 | 174 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 57.694 | 14 | 174 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.1E-27 | 15 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 255 aa Download sequence Send to blast |
MEKLNFVKNG AVRLPPGFRF HPTDEELVVQ YLKRKVFACP LPASIIPEVD VCKSDPWDLP 60 GDLEQERYFF STREAKYPNG NRSNRATGSG YWKATGIDKQ IVTSKGNQAV GMKKTLVFYR 120 GKPPHGTRTD WIMHEYRLAS TETAACNALL NKNSIQGSVV VPMENWVLCR IFLKKRSTKN 180 EEENMQFGND NRLSKLRTTK PVFYDFMTKH RTTDLNLAPS SSSGSSGITE VSCNESDDHE 240 ESSSCNSFPY FRRKP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-51 | 12 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-51 | 12 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-51 | 12 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-51 | 12 | 179 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-51 | 12 | 179 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-51 | 12 | 179 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-51 | 12 | 179 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP770012 | 0.0 | KP770012.1 Populus tomentosa apical meristem (NAM) family protein (Potri.001G061200) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011020822.1 | 0.0 | PREDICTED: NAC transcription factor ONAC010-like | ||||
Swissprot | Q9FY93 | 1e-107 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | B9GZC3 | 0.0 | B9GZC3_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0003s16490.1 | 0.0 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-108 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|