![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG031259.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 96aa MW: 10335.4 Da PI: 8.0518 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104.1 | 8.6e-33 | 27 | 83 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +v+Y eC+kNhAa +Gg+avDGC+Efm+s geegtaaal+CaACgCHRnFHRreve+e CCG031259.1 27 NVKYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTAAALTCAACGCHRNFHRREVETE 83 79**************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 8.9E-31 | 27 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 6.0E-17 | 29 | 93 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.7E-27 | 29 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 26.294 | 30 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MRKRQVVVRR SEEPSRSSTT SSFTVRNVKY GECQKNHAAG VGGYAVDGCR EFMASGEEGT 60 AAALTCAACG CHRNFHRREV ETEVACDCSS PSSNGN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011008116.1 | 1e-64 | PREDICTED: mini zinc finger protein 2 | ||||
Refseq | XP_024444589.1 | 2e-64 | mini zinc finger protein 2 | ||||
Swissprot | Q9LJW5 | 6e-45 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A3N7H5T0 | 4e-63 | A0A3N7H5T0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0017s11900.1 | 1e-64 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 5e-26 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|