PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG022692.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 74aa MW: 8596.29 Da PI: 4.1393 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 37.6 | 5e-12 | 25 | 68 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++ ++++E+ l+++ +++ G + W++Ia +++ gRt++++ +w++ CCG022692.1 25 KLEFSEDEEALIIRMFNLVGER-WSLIAGRIP-GRTAEEIEKYWNT 68 678*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.703 | 20 | 74 | IPR017930 | Myb domain |
SMART | SM00717 | 4.7E-10 | 24 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.4E-11 | 26 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.0E-15 | 27 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.4E-9 | 27 | 70 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.29E-8 | 27 | 68 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MADSEHSSSD ETSVYSREET SQESKLEFSE DEEALIIRMF NLVGERWSLI AGRIPGRTAE 60 EIEKYWNTRY STSE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CU226488 | 2e-96 | CU226488.1 Populus EST from severe drought-stressed leaves. | |||
GenBank | CU226991 | 2e-96 | CU226991.1 Populus EST from severe drought-stressed leaves. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011007897.1 | 2e-46 | PREDICTED: MYB-like transcription factor ETC1 isoform X2 | ||||
Swissprot | Q9LNI5 | 1e-15 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | B9HZL8 | 9e-43 | B9HZL8_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0011s00390.1 | 1e-43 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2692 | 31 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 5e-18 | MYB_related family protein |