PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CCG022621.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 95aa MW: 11444.9 Da PI: 9.7204 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.8 | 1.2e-08 | 33 | 72 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++E++l+++ +++ G + W++Ia +++ gR ++++ +w CCG022621.1 33 MSEQEEDLIYRMHRLVGER-WDLIAGRIP-GRKAEEIERFWI 72 79*****************.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.6E-6 | 29 | 77 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.63E-6 | 32 | 71 | No hit | No description |
Pfam | PF00249 | 4.7E-8 | 33 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.14E-7 | 34 | 75 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.2E-10 | 34 | 72 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MESMNRRRRR KQPKINSSES EEVSSIEWEF INMSEQEEDL IYRMHRLVGE RWDLIAGRIP 60 GRKAEEIERF WIMKHREGFA GNGKLYNEVK SRTSS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP723393 | 1e-148 | KP723393.1 Populus tremula x Populus tremuloides clone INRA 353-38 R3 MYB repressor protein (MYB179) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011007923.1 | 8e-63 | PREDICTED: MYB-like transcription factor ETC3 | ||||
Swissprot | Q8GV05 | 6e-39 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A0C4ZP98 | 4e-61 | A0A0C4ZP98_POPPZ; R3 MYB repressor protein | ||||
STRING | POPTR_0015s02310.1 | 5e-61 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3583 | 27 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 5e-32 | MYB_related family protein |