PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

CA08g12870

Organism

Capsicum annuum

Taxonomic ID

4072

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum

Family

TALE

Protein Properties

Length: 151aa MW: 17218.2 Da PI: 5.1062

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
CA08g12870	genome	PEP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	31.2	3.7e-10	84	117	22	55
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ee+ +L++ +gL+++q+ +WF N+R ++ CA08g12870 84 WPYPTEEEKNRLSEMTGLDQKQINNWFINQRKRH 117 58*****************************985 PP
2	ELK	40.2	7.1e-14	37	58	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++L+rKYsgyL+sL++EF+ CA08g12870 37 ELKEMLMRKYSGYLSSLRKEFL 58 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	7.5E-11	37	58	IPR005539	ELK domain
SMART	SM01188	3.1E-7	37	58	IPR005539	ELK domain
PROSITE profile	PS51213	11.383	37	57	IPR005539	ELK domain
PROSITE profile	PS50071	12.681	57	120	IPR001356	Homeobox domain
SuperFamily	SSF46689	6.42E-19	59	129	IPR009057	Homeodomain-like
SMART	SM00389	8.1E-13	59	124	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	6.5E-26	62	122	IPR009057	Homeodomain-like
Pfam	PF05920	1.2E-16	77	116	IPR008422	Homeobox KN domain
CDD	cd00086	7.91E-13	82	121	No hit	No description
PROSITE pattern	PS00027	0	95	118	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 151 aa Download sequence Send to blast
MSITDEAGGT SDDDLGCEEM EAADGQESPA SREGDNELKE MLMRKYSGYL SSLRKEFLKK 60 RKKGKLPKDA RIALMDWWNT HNRWPYPTEE EKNRLSEMTG LDQKQINNWF INQRKRHWRP 120 SEDMKFALME GVSAGSMYFD GPGGTGSIDT *

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	52	61	LRKEFLKKRK
2	58	62	KKRKK

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF375968	1e-156	AF375968.1 Lycopersicon esculentum knotted homeodomain protein 4 (KN4) mRNA, partial cds.
GenBank	AF533597	1e-156	AF533597.1 Lycopersicon esculentum knotted protein TKN4 (kn4) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016538789.1	1e-106	PREDICTED: homeobox protein knotted-1-like 1
Swissprot	A2Y007	1e-55	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	1e-55	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A2G3AWV4	1e-105	A0A2G3AWV4_CAPCH; Homeobox protein knotted-1-like 10
STRING	Solyc01g100510.2.1	5e-87	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA753	24	80

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G70510.1	7e-36	KNOTTED-like from Arabidopsis thaliana 2

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]