 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
CA04g06890 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
Family |
SRS |
Protein Properties |
Length: 110aa MW: 12656.6 Da PI: 9.5849 |
Description |
SRS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
CA04g06890 | genome | PEP | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | DUF702 | 121.2 | 1.3e-37 | 11 | 78 | 2 | 69 |
DUF702 2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaae 69
+sg++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thvkstWvpaakrrerqqqla+++++++++ ++
CA04g06890 11 NSGAISCQDCGNQAKKDCQHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLASLNQQEENKFKR 78
57899****************************************************98887665433 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription activator involved in the transcriptional regulation of terpene biosynthesis in glandular trichomes (PubMed:24884371, PubMed:24142382). Binds to the promoter of the linalool synthase TPS5 and promotes TPS5 gene transactivation (PubMed:24884371, PubMed:24142382). Acts synergistically with MYC1 in the transactivation of TPS5 (PubMed:24884371). {ECO:0000269|PubMed:24142382, ECO:0000269|PubMed:24884371}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | HG975442 | 6e-76 | HG975442.1 Solanum pennellii chromosome ch03, complete genome. |
GenBank | KC331911 | 6e-76 | KC331911.1 Solanum lycopersicum expression of terpenoids 2 mRNA, complete cds. |