![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | CA01g13280 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 147aa MW: 16658.1 Da PI: 10.5072 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.9 | 1.6e-16 | 78 | 122 | 4 | 48 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 ++r rrk+kNRe+A rsR+RK+a+ eL +kv Le+eN++Lkke CA01g13280 78 DRRLRRKIKNRESAARSRARKQAYHNELVNKVSHLEEENMKLKKE 122 6899***************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 4.2E-14 | 75 | 122 | No hit | No description |
SMART | SM00338 | 5.0E-12 | 75 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.76 | 77 | 122 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.6E-14 | 78 | 122 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 7.77E-17 | 79 | 121 | No hit | No description |
SuperFamily | SSF57959 | 1.38E-11 | 79 | 123 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 82 | 97 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MNNQEREPTL GETTLEDYLV KAGLFVADAS LGHTMSLDNP AAMQNYVPPT GLSPSPSLSD 60 TPISGRKRGA RDIDKTIDRR LRRKIKNRES AARSRARKQA YHNELVNKVS HLEEENMKLK 120 KEKVWVLSLS ILRLKMLDIS FDKKHF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 2e-58 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016577983.1 | 3e-86 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Refseq | XP_016577992.1 | 3e-86 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9C5Q2 | 3e-21 | AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3 | ||||
TrEMBL | A0A2G3AI81 | 1e-103 | A0A2G3AI81_CAPAN; Uncharacterized protein | ||||
STRING | Solyc01g008980.2.1 | 9e-79 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12596 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G41070.3 | 3e-16 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|