PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | C.cajan_45774 | ||||||||
Common Name | KK1_046258 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 92aa MW: 10664.2 Da PI: 7.9529 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.5 | 2.1e-15 | 11 | 57 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+W+ +E+ +l+++v+ +G g+W + + g++R++++ck+rw++yl C.cajan_45774 11 GAWSSQEEGILINYVQVHGEGNWGDLPLRAGLKRCGESCKHRWLNYL 57 89********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.88 | 1 | 61 | IPR017930 | Myb domain |
SMART | SM00717 | 1.5E-9 | 9 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-16 | 10 | 60 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.0E-13 | 11 | 57 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.32E-18 | 11 | 85 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.26E-7 | 12 | 57 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MESKTCCENE GAWSSQEEGI LINYVQVHGE GNWGDLPLRA GLKRCGESCK HRWLNYLKPR 60 GRNISLDEQE LIIRLHKLLG NRYYITLFSL TL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | C.cajan_45774 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_029126100.1 | 9e-54 | transcription factor MYB32-like | ||||
Swissprot | P10290 | 2e-28 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A151QRL5 | 4e-61 | A0A151QRL5_CAJCA; Anthocyanin regulatory C1 protein | ||||
STRING | XP_007138671.1 | 1e-38 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 1e-28 | MYB family protein |