PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus

Family

M-type_MADS

Protein Properties

Length: 77aa MW: 8953.49 Da PI: 10.4584

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
C.cajan_40507	genome	IIPG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	103	1.1e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s C.cajan_40507 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.403	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	5.7E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.81E-39	2	61	No hit	No description
SuperFamily	SSF55455	3.66E-31	2	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.1E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.2E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFST RGKLYEFCSS 60 SRFVLFLPLH SYSNEIQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	3e-21	1	73	1	73	MEF2 CHIMERA
6byy_B	3e-21	1	73	1	73	MEF2 CHIMERA
6byy_C	3e-21	1	73	1	73	MEF2 CHIMERA
6byy_D	3e-21	1	73	1	73	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	C.cajan_40507

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015044	8e-93	AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028059218.1	3e-37	MADS-box protein EJ2-like
Swissprot	Q8LLR2	5e-37	MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBL	A0A151RCR0	1e-48	A0A151RCR0_CAJCA; Agamous-like MADS-box protein AGL9 isogeny
STRING	Aquca_002_00913.1	3e-37	(Aquilegia coerulea)
STRING	cassava4.1_030388m	2e-37	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	2e-38	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751]